Recombinant Psychromonas ingrahamii Probable intracellular septation protein A (Ping_1054)

Shipped with Ice Packs
In Stock

Description

Functional and Genomic Context

Ping_1054 is annotated as an intracellular septation protein critical for cell division, likely participating in membrane-associated processes during bacterial cytokinesis . Key genomic insights include:

  • Gene Location: Chromosome (NC_008709.1, positions 1,328,295–1,328,864, complement) .

  • Operonic Context: Co-localized with genes encoding tryptophan synthase subunits (Ping_1055–Ping_1059), anthranilate synthase, and translation factors, suggesting potential regulatory or metabolic linkages .

  • Taxonomic Classification: Belongs to the Psychromonadaceae family within Gammaproteobacteria, adapted to extreme psychrophily .

Protein Characteristics

PropertyDescription
Molecular Weight21,574 Da (predicted)
Amino Acid Sequence189 residues (MKQFFEFIPL...ISANKNPEE)
Isoelectric PointNot experimentally determined; computational tools required for prediction.
Structural FeaturesMulti-pass inner membrane protein with α-helical transmembrane domains (predicted via AlphaFold) .
Post-Translational ModificationsContains disulfide bonds (inferred from cysteine-rich regions) .

Recombinant Production and Purification

Recombinant Ping_1054 is expressed in heterologous systems (e.g., E. coli, yeast, or mammalian cells) with tags (N-/C-terminal) to enhance stability and solubility . Key production details:

  • Purity: ≥85% (SDS-PAGE verification) .

  • Storage: Lyophilized or liquid format at -20°C or -80°C .

  • Endotoxin Levels: Low endotoxin variants available for sensitive applications .

Research Applications

  • Cell Division Studies: Used to investigate membrane dynamics in psychrophilic bacteria .

  • Protein-Protein Interaction Screens: Tagged variants enable pull-down assays to identify septation-related partners.

  • Biophysical Characterization: Stability assays under low-temperature conditions to elucidate cold adaptation .

Evolutionary and Ecological Significance

P. ingrahamii’s genome encodes 61 cyclic GDP regulators and 11 TRAP transporters, likely supporting survival in freezing environments . Ping_1054’s role in septation may be optimized for low-energy processes, a trait linked to psychrophily .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
yciB; Ping_1054; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Psychromonas ingrahamii (strain 37)
Target Names
Ping_1054
Target Protein Sequence
MKQFFEFIPLIIFFVVFKTTDIYIATGALIVSMGLMLAFNYYKDGKVEKMQVITFGMVLV FGTLTIVLHDDVFIKWKVTVVYALFSLALLVSQFFYKKPIIKQMLSKEINLPANIWNNLN MAWALLFAVLSAVNVYVAFSLSQETWVNFKVFGLLAITLAFTLLSGLYIYKYLPATAEKK ISANKNPEE
Uniprot No.

Target Background

Function
Plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Psychromonas ingrahamii and why is it significant for protein research?

Psychromonas ingrahamii is an extreme psychrophile isolated from sea ice that demonstrates the remarkable ability to grow exponentially at temperatures as low as -12°C. This organism represents a valuable model for studying cold adaptation mechanisms in proteins and cellular processes. The genome sequence of P. ingrahamii has been fully determined, enabling comparative genomic analyses with mesophilic organisms to identify cold-adaptive features .

P. ingrahamii possesses several genomic features that likely contribute to its psychrophilic nature, including:

  • A large number (61) of regulators of cyclic GDP, suggesting production of extracellular polysaccharides that may help sequester water or lower the freezing point in the microenvironment surrounding the cell

  • Genes for the production of osmolytes such as betaine choline, which may help balance osmotic pressure during freezing conditions

  • Numerous (11) three-subunit TRAP systems potentially involved in nutrient transport at low temperatures

  • Specialized chaperones and stress proteins that may assist in proper protein folding at low temperatures

What is the function of intracellular septation proteins in bacteria?

Intracellular septation proteins play critical roles in bacterial cell division processes. While specific information about Ping_1054 is limited in the available literature, we can draw parallels with other characterized septation proteins such as IspA from Shigella flexneri. The ispA gene in S. flexneri encodes a small (21 kDa), highly hydrophobic protein that is essential for proper cell division and virulence .

When the ispA gene is disrupted in S. flexneri, bacteria develop defects in cell division, resulting in long filamentous bacteria lacking proper septa. This disruption also affects the bacterium's ability to polymerize actin, which is necessary for intercellular spreading during infection . By analogy, Ping_1054 in P. ingrahamii may serve similar functions in cell division processes, potentially with cold-adaptive modifications that allow it to function at extremely low temperatures.

What methodological approaches are recommended for expressing recombinant proteins from psychrophilic organisms?

When working with recombinant proteins from psychrophilic organisms like P. ingrahamii, researchers should consider the following methodological approaches:

Methodological AspectRecommended ApproachRationale
Expression systemCold-adapted expression hosts (e.g., Arctic Express™)Better folding of psychrophilic proteins at lower temperatures
Growth temperature4-15°C during induction phaseMaintains protein structure and prevents aggregation
Buffer compositionInclude cryoprotectants and compatible solutesStabilizes protein structure during purification
Purification strategyRapid purification at low temperaturesMinimizes thermal denaturation and proteolysis
Storage conditionsFlash-freezing in buffer with stabilizersPreserves activity during long-term storage

When designing your experimental protocols, remember that qualitative and quantitative approaches can complement each other. For structural and functional studies, primary research through experimental methods is typically necessary, while secondary research of existing literature can provide valuable context .

How can researchers resolve contradictory findings when characterizing proteins like Ping_1054?

Contradictions in research findings are common in the biomedical literature, particularly when studying novel proteins like Ping_1054. These contradictions frequently arise from differences in experimental context that may not be immediately apparent. When faced with contradictory results about Ping_1054 or similar proteins, consider the following systematic approach:

  • Context Analysis: Carefully examine methodological differences between studies, including:

    • Species or strain variations

    • Temporal context (growth phase, temperature adaptation periods)

    • Environmental conditions (media composition, pH, salt concentration)

    • Protein preparation methods (tags, purification protocols)

  • Normalization Issues: Ensure proper normalization of terminology and protein identifiers across studies. Differences in nomenclature, gene/protein naming conventions, or the use of non-standardized abbreviations can create apparent contradictions .

  • Systematic Review Approach: Implement a structured analysis similar to that used by Alamri and Stevenson, where clear yes/no questions about specific protein characteristics are formulated and evidence from multiple studies is systematically evaluated .

  • Data Integration Strategy: Develop a comprehensive data matrix that includes:

Study ParameterStudy 1Study 2Study 3etc.
Organism strain
Growth conditions
Protein construct
Purification method
Experimental assay
Result
Statistical significance

This methodical approach can help identify the source of contradictions and determine whether they represent actual biological differences or methodological artifacts.

What experimental approaches are recommended for studying the structure-function relationship of cold-adapted proteins like Ping_1054?

Understanding the structure-function relationships of cold-adapted proteins requires specialized experimental approaches. The structural analysis of serine hydroxymethyltransferase (SHMT) from P. ingrahamii provides insights into such approaches :

  • Comparative Structural Analysis: Determine the protein structure in both apo (cofactor-free) and holo (cofactor-bound) forms to identify conformational changes that occur upon ligand binding. X-ray crystallography has been successfully used for P. ingrahamii SHMT and revealed that the apo form exists in an "open" conformation with disordered loops, while cofactor binding triggers a rearrangement where the small domain moves toward the large domain .

  • Conformational Dynamics Assessment: Compare the backbone conformational changes between psychrophilic and mesophilic homologs. Research has shown that psychrophilic SHMTs display wider conformational changes than their mesophilic counterparts, which may contribute to their activity at low temperatures .

  • Domain Movement Analysis: Examine the relative movement of protein domains during substrate binding or catalysis, as these movements may be adapted for cold temperatures. For example, in P. ingrahamii SHMT, the small domain moves to screen the pyridoxal-5'-phosphate binding site from the solvent upon cofactor binding .

  • Disorder-to-Order Transition Studies: Analyze regions that transition from disordered to ordered states upon ligand binding, as these may be particularly important for cold adaptation. In P. ingrahamii SHMT, several disordered loops become ordered when the cofactor binds .

How does protein hydrophobicity contribute to cold adaptation in P. ingrahamii proteins?

The analysis of protein composition in P. ingrahamii has revealed interesting patterns regarding hydrophobicity that may contribute to cold adaptation:

The table below summarizes key hydrophobicity-related adaptations observed in psychrophilic proteins compared to mesophilic homologs:

AdaptationPsychrophilic ProteinsMesophilic ProteinsFunctional Impact
Surface hydrophobicityReducedHigherIncreases protein-water interactions, preventing cold denaturation
Core hydrophobicityReducedHigherIncreases internal flexibility at low temperatures
Charged vs. hydrophobic residuesMore charged residues on surfaceMore hydrophobic residuesEnhances solubility in cold environments
Membrane protein hydrophobicityLowerHigherMaintains membrane fluidity at low temperatures

What are the optimal experimental conditions for assessing Ping_1054 function in vitro?

When designing experiments to study the function of Ping_1054 in vitro, researchers should consider the following methodological parameters:

  • Temperature Range: Experiments should be conducted across a temperature gradient (e.g., -12°C to 20°C) to capture both the psychrophilic optimal range and comparative mesophilic conditions. This approach allows for the determination of temperature-activity profiles and thermal stability characteristics.

  • Buffer Optimization: Standard buffers may freeze at the temperatures where P. ingrahamii proteins function optimally. Consider using:

    • Higher buffer concentrations (50-100 mM)

    • Addition of cryoprotectants (glycerol, trehalose)

    • Anti-freeze proteins or synthetic antifreeze compounds

    • Compatible solutes found in P. ingrahamii (e.g., betaine choline)

  • Experimental Design Approaches: Both descriptive and experimental methods should be employed:

    • Descriptive methods to characterize the protein's properties under native-like conditions

    • Experimental methods involving systematic manipulation of variables to establish causal relationships

  • Data Collection Methods: For quantitative analysis of Ping_1054 function, consider:

    • Spectroscopic methods adapted for low-temperature measurements

    • Fluorescence-based assays for tracking protein-protein interactions

    • Modified kinetic assays that account for reduced reaction rates at low temperatures

How can genetic manipulation techniques be adapted for studying Ping_1054 in P. ingrahamii?

Studying the function of Ping_1054 in its native context requires genetic manipulation of P. ingrahamii, which presents unique challenges due to its psychrophilic nature. Drawing from approaches used for other bacterial systems, researchers might consider:

  • Mutagenesis Approach: Targeted gene disruption through Tn10 mutagenesis has been successfully used in bacteria to study essential genes. This approach identified ispA as an essential virulence gene in Shigella flexneri . A similar approach could be adapted for P. ingrahamii, with appropriate modifications for low-temperature growth conditions.

  • Complementation Analysis: After generating Ping_1054 mutants, complementation studies with the wild-type gene can confirm gene function. This approach was successfully used to verify ispA function in S. flexneri by cloning the gene from the chromosome and demonstrating that it complemented the mutation .

  • Phenotypic Analysis: For septation proteins, microscopic examination of cell morphology is crucial. In S. flexneri, ispA mutation led to observable defects in cell division and the formation of filamentous bacteria lacking septa . Similar phenotypic analyses should be conducted for Ping_1054 mutants.

  • Molecular Tagging Strategies: When performing recombinant expression or cellular localization studies, consider:

Tagging ApproachAdvantagesConsiderations for Psychrophiles
N-terminal tagsLess likely to interfere with C-terminal functionsMay disrupt signal sequences
C-terminal tagsPreserves native N-terminusMay interfere with membrane localization
Internal tagsMinimal disruption to terminiRequires detailed structural knowledge
Split tagsAllows protein-protein interaction studiesMay not fold properly at low temperatures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.