Recombinant Psychromonas ingrahamii Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

General Overview

Prolipoprotein diacylglyceryl transferase (lgt) is a membrane-bound enzyme that catalyzes the first step in bacterial lipoprotein modification. This enzyme transfers an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the invariant cysteine residue in the lipobox motif of prolipoproteins . This post-translational modification is crucial for the proper functioning and localization of bacterial lipoproteins, which play diverse roles including nutrient acquisition, signaling, and maintaining cell envelope integrity.

Significance in Bacterial Physiology

Lgt plays an essential role in bacterial physiology as evidenced by studies in Escherichia coli demonstrating that lgt is required for growth, based on analysis of an lgt depletion strain . The enzyme is part of a three-step pathway for lipoprotein modification in bacteria, where it catalyzes the initial step. Following lgt-mediated diacylglyceryl transfer, the signal peptide is cleaved by signal peptidase II (lsp), and in many bacteria, a third enzyme, apolipoprotein N-acyltransferase (lnt), adds a third acyl group to the α-amino group of the modified cysteine . This sequential modification process is critical for proper lipoprotein localization and function.

Psychromonas ingrahamii: An Extremely Psychrophilic Bacterium

Psychromonas ingrahamii is an exceptionally cold-adapted bacterium that grows exponentially at 5°C and can even grow at temperatures as low as -12°C . This microorganism has attracted significant attention due to its extraordinary adaptation to cold environments, making its enzymes, including lgt, potential candidates for biotechnological applications that require activity at low temperatures. The extreme psychrophilic nature of P. ingrahamii suggests that its enzymes have evolved unique structural and functional features that enable efficient catalysis under cold conditions where most mesophilic enzymes would show reduced activity.

Comparison with Lgt from Other Bacterial Species

Comparative analyses of lgt enzymes from different bacterial species have revealed important insights into their structure-function relationships. Studies on E. coli, Salmonella typhimurium, Haemophilus influenzae, and Staphylococcus aureus lgt proteins identified regions of highly conserved amino acid sequences throughout the molecule . The S. aureus lgt showed 24% identity and 47% similarity with E. coli, S. typhimurium, and H. influenzae lgt enzymes, despite being 12 amino acids shorter than the E. coli enzyme .

Table 1: Comparison of lgt Characteristics Across Bacterial Species

FeatureP. ingrahamii LgtE. coli LgtS. aureus LgtOther Bacterial Lgt
Length (amino acids)287~291*279Variable
Growth temperaturePsychrophilic (-12°C to 5°C)MesophilicMesophilicSpecies-dependent
Sequence conservationContains lgt signature motif (inferred)Contains highly conserved residues24% identity, 47% similarity with E. coliVariable conservation
Membrane integrationMultiple transmembrane segments (predicted)7 transmembrane segmentsMultiple transmembrane segments (predicted)Typically multi-pass transmembrane

*Estimated based on S. aureus being 12 amino acids shorter than E. coli lgt

Conserved Domains and Functional Motifs

The longest set of identical amino acids without any gap across E. coli, S. typhimurium, H. influenzae, and S. aureus was identified as H-103-GGLIG-108, highlighting its potential importance for the enzyme's function . Indeed, in an E. coli lgt mutant (strain SK634), a substitution of Gly-104 to Ser in this region resulted in temperature sensitivity in growth and exhibited low lgt activity in vitro .

Studies on E. coli lgt have identified several highly conserved amino acids essential for its function. Site-directed mutagenesis revealed that residues Y26, N146, and G154 are absolutely required for lgt function, while R143, E151, R239, and E243 are also important for optimal activity . Given the high conservation of key functional residues among bacterial lgt enzymes, it is likely that P. ingrahamii lgt shares similar functional residues, though potentially adapted for optimal function at low temperatures.

Enzymatic Mechanism

The enzymatic mechanism of lgt involves the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the invariant cysteine residue in the lipobox motif of prolipoproteins . This results in the formation of a thioether-linked diacylglyceryl-prolipoprotein and glycerolphosphate as a by-product .

Chemical modification studies on E. coli lgt have provided insights into the catalytic mechanism. Diethylpyrocarbonate inactivated the E. coli lgt with a second-order rate constant of 18.6 M⁻¹s⁻¹, and this inactivation was reversible by hydroxylamine at pH 7 . The inactivation kinetics were consistent with the modification of a single residue, either histidine or tyrosine, essential for lgt activity .

Substrate Specificity

Lgt enzymes recognize prolipoproteins containing a specific sequence motif known as the lipobox [L-A(S)-G(A)-C] . The invariant cysteine residue in this motif becomes the first amino acid of the mature protein after modification. Lgt transfers the diacylglyceryl group from phosphatidylglycerol to this cysteine residue.

Cold Adaptation Features

As an enzyme from an extremely psychrophilic bacterium, P. ingrahamii lgt likely exhibits features characteristic of cold-adapted enzymes. While specific information on the cold adaptation of P. ingrahamii lgt is not available in the current literature, insights can be drawn from studies of other psychrophilic enzymes from the same organism.

Serine hydroxymethyltransferase from P. ingrahamii, for example, displays decreased thermostability and high specific activity at low temperature, both typical features of cold-adapted enzymes . It also shows enhanced catalytic efficiency, particularly for side reactions, compared to its mesophilic counterpart from E. coli .

Similar adaptations might be expected in P. ingrahamii lgt, such as increased structural flexibility, reduced thermal stability, and optimized catalytic parameters at low temperatures. These adaptations would enable the enzyme to function efficiently in the extreme cold environments inhabited by P. ingrahamii, where membrane fluidity is reduced and enzyme kinetics are typically slower.

Expression Systems and Purification

The recombinant production of P. ingrahamii lgt has been achieved, as evidenced by the commercial availability of the recombinant protein . While specific details on the expression system used for this production are not provided in the available literature, the recombinant protein is described as having the full-length sequence (amino acids 1-287) .

Studies on other enzymes from P. ingrahamii, such as serine hydroxymethyltransferase, have utilized Escherichia coli as an expression host, with the enzyme purified as a His-tag fusion protein . Similarly, a nuclease from P. ingrahamii (PinNuc) was expressed in Pichia pastoris . These examples suggest that both bacterial and yeast expression systems might be suitable for the recombinant production of P. ingrahamii lgt.

Biochemical Characterization

While detailed biochemical characterization studies specific to recombinant P. ingrahamii lgt are not available in the current literature, the enzyme is expected to retain the fundamental catalytic function of transferring a diacylglyceryl group from phosphatidylglycerol to the cysteine residue in the lipobox of prolipoproteins.

Given its origin from an extremely psychrophilic organism, the recombinant enzyme might exhibit higher catalytic efficiency at low temperatures compared to lgt enzymes from mesophilic bacteria. Studies on other cold-adapted enzymes have shown that they typically have lower activation energies, higher catalytic rates (kcat) at low temperatures, and often show higher substrate affinity (lower Km) under cold conditions .

Biotechnological Applications

Enzymes from psychrophilic organisms, including P. ingrahamii, have significant potential for biotechnological applications due to their unique adaptations for activity at low temperatures. While specific applications of P. ingrahamii lgt are not detailed in the available literature, several potential applications can be envisioned.

The ability of psychrophilic enzymes to function efficiently at low temperatures makes them valuable for processes that benefit from low-temperature conditions, such as:

  1. Biotransformations requiring low temperatures to prevent substrate/product degradation

  2. Processes where energy conservation through reduced heating is desirable

  3. Production of heat-sensitive compounds

  4. Low-temperature industrial processes in food, pharmaceutical, and detergent industries

Specifically, P. ingrahamii lgt might find applications in processes that require lipid modification of proteins at low temperatures or in the development of novel biosynthetic pathways for the production of lipidated proteins or peptides with potential applications in drug delivery, vaccine development, or as biosurfactants.

Research Applications

Recombinant P. ingrahamii lgt could serve as a valuable research tool for investigating:

  1. Lipoprotein biology in the context of cold adaptation

  2. Structural determinants of cold adaptation in membrane-bound enzymes

  3. Evolution of psychrophilic enzymes

  4. Mechanisms of protein-lipid interactions at low temperatures

Furthermore, comparative studies of lgt enzymes from psychrophilic, mesophilic, and thermophilic organisms could provide insights into the molecular mechanisms of enzyme temperature adaptation and contribute to our understanding of how enzymes evolve to function under extreme conditions.

Future Research Directions

Several avenues for future research on P. ingrahamii lgt could significantly advance our understanding of this enzyme:

  1. Detailed structural characterization through X-ray crystallography or cryo-electron microscopy

  2. Comprehensive kinetic analysis at different temperatures

  3. Molecular dynamics simulations to understand the basis of cold adaptation

  4. Protein engineering to enhance specific properties for particular applications

  5. Exploration of substrate scope and potential promiscuous activities

  6. Investigation of the enzyme's behavior in different membrane environments

Such studies would not only enhance our understanding of this fascinating cold-adapted enzyme but could also lead to novel applications in biotechnology and contribute to our broader knowledge of enzyme adaptation to extreme environments.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipment is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
lgt; Ping_0505; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Psychromonas ingrahamii (strain 37)
Target Names
lgt
Target Protein Sequence
MSVSNFVLPKIDPVAVSIGPVDIHWYGLMYLLGFTFALWMANRQCDKSNGIWTREQASDL LFYGFMGVILGGRIGYVLFYQFPLFLDSPLYLFKIWEGGMSFHGGVLGVTTAIIFYAKKN KRSILSVGDFIVPLLPVGLGAGRIGNFINSELWGRVTDSPFGIIFQNAGPLPRHPSQLYE FALEGVVLFIILILYIRKARPAGSVAGLFLLAYGVFRFIVEFAREPDAHLGLLSLGLSMG QLLSLPMIFAGMAFIAYAYRAKAQAPSQADNVKPPKAKTNKAKKKHG
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Psychromonas ingrahamii and why is its lgt protein significant?

Psychromonas ingrahamii is an extreme psychrophilic bacterium isolated from sea ice in the Arctic (Alaska, Point Barrow, Elson Lagoon). It is remarkable for its ability to grow exponentially at temperatures as low as -12°C, making it one of the most cold-adapted organisms known . The lgt protein (prolipoprotein diacylglyceryl transferase) from this organism is significant because it functions at extremely low temperatures, catalyzing a critical step in bacterial lipoprotein biogenesis. Understanding how this enzyme maintains functionality in cold environments provides insights into cold adaptation mechanisms and potential biotechnological applications .

What is the fundamental role of lgt in bacterial physiology?

Lgt (prolipoprotein diacylglyceryl transferase) catalyzes the first and critical step in bacterial lipoprotein biogenesis. It transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the invariant cysteine residue in the "lipobox" sequence of prolipoproteins . This post-translational modification is essential for proper anchoring of lipoproteins to the bacterial membrane. The lgt gene is considered essential for survival in most Gram-negative bacteria, as its deletion is typically lethal . In the context of P. ingrahamii, this enzyme must perform this critical function even at extremely low temperatures.

What are the structural characteristics of P. ingrahamii lgt?

P. ingrahamii lgt is an integral membrane protein of 287 amino acids. Based on its sequence and homology to the characterized E. coli lgt, it likely contains multiple transmembrane domains . The protein has a molecular weight of approximately 32 kDa and features multiple hydrophobic regions consistent with its membrane-embedded nature. The amino acid composition may reflect cold adaptation strategies, including potentially higher proportions of asparagine and lower amounts of oxygen-sensitive residues like cysteine, methionine, arginine, and histidine compared to mesophilic counterparts .

What are the optimal expression systems for producing recombinant P. ingrahamii lgt?

For recombinant expression of P. ingrahamii lgt, a modified E. coli expression system is recommended with the following considerations:

  • Expression vector selection: Use vectors with cold-inducible promoters (such as the cspA promoter) to allow expression at lower temperatures (12-15°C).

  • Host strain optimization: E. coli Arctic Express or similar strains containing cold-adapted chaperones help with proper protein folding.

  • Induction protocol: Slow induction at 12-15°C for 24-48 hours yields better results than standard protocols at higher temperatures.

  • Membrane protein considerations: Include fusion tags (such as GFP or MBP) that can monitor proper folding and aid in purification.

This approach accommodates the psychrophilic nature of the protein and increases the likelihood of obtaining functionally active enzyme .

What purification strategies are most effective for P. ingrahamii lgt?

Purification of P. ingrahamii lgt requires special considerations due to its membrane-bound nature:

  • Membrane fraction isolation: After cell lysis, separate membrane fractions through ultracentrifugation (100,000 × g for 1 hour).

  • Detergent solubilization: Test a panel of detergents; mild detergents like DDM (n-dodecyl-β-D-maltopyranoside) at 1-2% are often effective.

  • Affinity chromatography: If using tagged recombinant protein, apply solubilized membranes to appropriate affinity resin.

  • Size exclusion chromatography: Further purify through gel filtration to remove aggregates and ensure homogeneity.

  • Quality control: Assess purity using SDS-PAGE and Western blotting, and verify activity using functional assays.

All steps should be performed at 4°C to maintain stability of this cold-adapted enzyme .

How can researchers assay the enzymatic activity of P. ingrahamii lgt?

To assay P. ingrahamii lgt activity, researchers can employ several complementary approaches:

  • In vitro transfer assay: Using synthetic lipobox-containing peptides and fluorescently labeled phosphatidylglycerol, measure the transfer of the diacylglyceryl moiety by monitoring fluorescence changes.

  • GFP-based assay: Similar to methods used for E. coli lgt, employ a GFP-fused lipobox peptide that changes localization upon modification, which can be monitored microscopically or through membrane fractionation .

  • Complementation assay: Test functional activity by attempting to complement lgt-knockout E. coli cells with the P. ingrahamii lgt gene, assessing rescue of the lethal phenotype at various temperatures .

  • Temperature-dependent activity profile: Measure enzyme kinetics across a temperature range (from -12°C to 37°C) to determine the temperature optimum and stability profile.

All assays should include controls with known lgt inhibitors like palmitic acid to confirm specificity .

How does the amino acid composition of P. ingrahamii lgt contribute to cold adaptation?

The amino acid composition of P. ingrahamii lgt likely reflects specific cold adaptation strategies:

These compositional biases likely contribute to maintaining proper folding, flexibility, and activity at near-freezing temperatures. The precise mechanisms may involve altered hydrogen bonding patterns, modified protein-lipid interactions, and enhanced structural flexibility .

How does P. ingrahamii lgt compare structurally and functionally to homologs from mesophilic bacteria?

While the crystal structure of P. ingrahamii lgt has not been directly reported in the search results, insights can be derived from comparing it with the characterized E. coli lgt structure:

What are the challenges in crystallizing membrane proteins like P. ingrahamii lgt?

Crystallizing membrane proteins like P. ingrahamii lgt presents several specific challenges:

  • Detergent selection: Finding the optimal detergent that maintains protein stability while allowing crystal contacts is critical. Often, a screening approach testing multiple detergents is necessary.

  • Temperature considerations: For psychrophilic proteins, crystallization at low temperatures may be required, which introduces complications for crystal growth and handling.

  • Lipid requirements: Co-crystallization with specific lipids or lipid-like molecules (as seen with E. coli lgt and phosphatidylglycerol or palmitic acid) may be essential for obtaining well-diffracted crystals .

  • Phase determination: Novel membrane protein structures often lack close homologs for molecular replacement, requiring experimental phasing methods.

  • Crystal quality: Membrane protein crystals frequently diffract to lower resolutions, requiring specialized refinement approaches.

Successful crystallization would likely require technology similar to that used for obtaining the 1.6-1.9Å resolution structures of E. coli lgt .

How has the extreme environment shaped the evolution of P. ingrahamii lgt?

The extreme cold environment has likely driven several evolutionary adaptations in P. ingrahamii lgt:

  • Selective pressure: The need to maintain membrane fluidity and proper lipoprotein processing at temperatures as low as -12°C has selected for specific adaptations in the enzyme.

  • Temperature-activity profile: Unlike mesophilic homologs, P. ingrahamii lgt has likely evolved to maintain optimal activity at much lower temperatures, with potential structural modifications to the active site and substrate binding regions.

  • Lipid environment adaptation: The enzyme has co-evolved with the modified membrane lipid composition found in psychrophiles, which typically includes increased proportions of unsaturated fatty acids to maintain membrane fluidity at low temperatures .

  • Amino acid compositional drift: The evolutionary process has selected for the increased asparagine content and decreased oxygen-sensitive amino acids observed in P. ingrahamii proteins broadly .

What genomic context surrounds the lgt gene in P. ingrahamii and how does it compare to other bacteria?

The genomic context of the lgt gene (Ping_0505) in P. ingrahamii provides insights into its regulation and potential functional connections:

  • Conservation and synteny: The lgt gene is likely part of conserved operons involved in cell envelope biogenesis, though the specific gene arrangements may differ from mesophilic bacteria.

  • Cold-responsive elements: Promoter regions may contain binding sites for cold-shock proteins or other transcription factors that regulate expression during temperature fluctuations.

  • Co-regulated genes: Genes involved in osmotic stress response (such as those producing betaine choline) and extracellular polysaccharide production may be co-regulated with lgt, reflecting the interconnected adaptations to sea ice environments .

  • Genomic plasticity: The P. ingrahamii genome shows evidence of specific adaptations to cold, including a large number (61) of regulators of cyclic GDP, suggesting production of extracellular polysaccharides that may help sequester water or lower the freezing point .

What are common difficulties in working with recombinant P. ingrahamii lgt and how can they be addressed?

Researchers working with recombinant P. ingrahamii lgt commonly encounter several challenges:

  • Protein instability: The psychrophilic nature of the protein can lead to instability at typical laboratory temperatures.

    • Solution: Maintain all expression, purification, and assay steps at 4°C or lower; consider using temperature-controlled chambers for extended procedures.

  • Inclusion body formation: Overexpression often leads to aggregation and inclusion body formation.

    • Solution: Use lower induction temperatures (12-15°C), employ solubility-enhancing fusion partners, and optimize expression levels.

  • Detergent-induced inactivation: Many detergents used for membrane protein solubilization can disrupt enzyme activity.

    • Solution: Screen multiple detergent types and concentrations; consider nanodisc or liposome reconstitution for activity studies.

  • Substrate availability: Natural substrates from a psychrophilic organism may have different properties.

    • Solution: Develop synthetic substrate analogs that mimic the natural phospholipid environment of P. ingrahamii .

How can researchers validate that recombinant P. ingrahamii lgt retains its native structure and function?

Validation of recombinant P. ingrahamii lgt's native structure and function requires multiple complementary approaches:

  • Functional complementation: Test if the recombinant protein can rescue lgt-deficient bacterial strains, particularly at low temperatures.

  • Temperature-activity profile: Verify that the enzyme displays higher activity at low temperatures compared to mesophilic homologs.

  • Circular dichroism spectroscopy: Compare secondary structure elements at different temperatures to assess proper folding.

  • Thermal shift assays: Confirm that the protein shows the expected lower thermal stability compared to mesophilic counterparts.

  • Substrate specificity: Test activity with various phospholipid substrates to ensure the enzyme maintains its native selectivity.

  • Site-directed mutagenesis: Verify that mutation of predicted critical residues (based on homology to E. coli lgt, like Arg143 and Arg239) abolishes activity .

What biotechnological applications might P. ingrahamii lgt have?

P. ingrahamii lgt holds potential for several biotechnological applications:

  • Cold-active enzymatic processes: As a cold-adapted enzyme, it could enable biotransformations at low temperatures, reducing energy costs and enabling temperature-sensitive reactions.

  • Protein engineering platform: Understanding its cold adaptation mechanisms provides templates for engineering other enzymes to function at low temperatures.

  • Lipoprotein display technology: Modified versions could enable efficient lipid anchoring of recombinant proteins to cell surfaces or liposomes at low temperatures.

  • Antibiotic development: As lgt is essential in most Gram-negative bacteria, insights from the P. ingrahamii enzyme could guide development of new antibiotics targeting this pathway but specific to mesophilic pathogens.

  • Membrane protein expression systems: Cold-adapted membrane protein biogenesis machinery could improve expression of difficult membrane proteins .

What are promising future research directions for understanding P. ingrahamii lgt?

Several promising research directions would advance understanding of P. ingrahamii lgt:

  • Structural determination: Resolving the crystal or cryo-EM structure of P. ingrahamii lgt would provide direct insights into cold adaptation mechanisms.

  • Lipid interactions: Investigating how the enzyme interacts with cold-adapted membrane lipids could reveal adaptations in the lateral access mechanism.

  • In vivo dynamics: Developing tools to study the enzyme's behavior in living P. ingrahamii cells at various temperatures would connect biochemical properties to cellular physiology.

  • Comparative enzymology: Systematic comparison with homologs from bacteria adapted to different temperature ranges would illuminate evolutionary pathways of cold adaptation.

  • Orphan protein interactions: Exploring potential interactions with the "orphan" hypothetical proteins identified in P. ingrahamii could reveal cold-specific protein networks .

  • TRAP system connections: Investigating relationships between lgt function and the abundant three-subunit TRAP transport systems found in P. ingrahamii might reveal integrated cold adaptation strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.