Recombinant Psychromonas ingrahamii UPF0761 membrane protein Ping_3482 (Ping_3482)

Shipped with Ice Packs
In Stock

Description

Gene Name and Synonyms

Ping_3482 is annotated under multiple names:

  • UPF0761 membrane protein

  • Ribonuclease BN (rbn)

  • Hypothetical protein

Proposed Functions

While its exact function remains unclear, genomic analyses suggest potential roles:

  1. Ribonuclease Activity: The "rbn" designation implies involvement in RNA processing, though experimental validation is lacking .

  2. Cold Adaptation: Psychromonas ingrahamii thrives at −12°C, and its genome includes features like osmolyte synthesis (e.g., betaine choline) and polysaccharide production to counteract freezing . Ping_3482 may contribute to membrane stability under low temperatures.

  3. Membrane Transport: As a UPF0761 family member, it could participate in nutrient uptake or signaling pathways, though no direct evidence exists .

Proposed FunctionSupporting EvidenceSource
Ribonuclease BNGene synonym "rbn" in IslandPath database
Cold AdaptationPart of P. ingrahamii genome with psychrophilic traits
Membrane TransportUPF0761 classification; membrane localization

Host Systems and Purification

Ping_3482 is typically expressed in E. coli due to its compatibility with prokaryotic expression systems . Key steps include:

  1. Vector Design: Full-length coding sequences cloned into pET or similar vectors.

  2. Purification: His-tag affinity chromatography followed by size-exclusion chromatography (SEC) for oligomerization analysis .

Production Challenges

Membrane proteins like Ping_3482 face challenges in recombinant expression:

  • Low Yield: Hydrophobic regions may trigger host stress responses, reducing solubility .

  • Oligomerization: SEC profiles suggest possible dimerization or complex formation, complicating functional studies .

ChallengeMitigation StrategySource
Low solubilityUse detergents (e.g., DDM, Cymal-6) during purification
Host stress responsesCo-expression with chaperones (e.g., GroEL)

Potential Research Applications

  1. Cold Adaptation Studies: Investigating how Ping_3482 maintains membrane fluidity at subzero temperatures.

  2. Enzymatic Characterization: Testing ribonuclease activity (e.g., cleavage of RNA substrates).

  3. Structural Biology: X-ray crystallography or cryo-EM to resolve transmembrane domains.

Unresolved Questions and Future Directions

  1. Functional Validation: Direct assays to confirm ribonuclease activity or membrane transport roles.

  2. Interaction Partners: Co-IP or crosslinking studies to identify binding partners in P. ingrahamii.

  3. Structural Insights: High-resolution structures to elucidate its mechanism of action.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes, and we will fulfill your request as much as possible.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: Our standard shipping includes blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference for your reconstitution.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ping_3482; UPF0761 membrane protein Ping_3482
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Psychromonas ingrahamii (strain 37)
Target Names
Ping_3482
Target Protein Sequence
MKFGRKIVMDKVKVTYQYLLFVWRRSEQDNIKVPAGHLAYVTLLSIVPLLAVIFYMLAAF PVFSDLKGMLEDLIYNNLLPTSGDTIQEHISGFIENTKKMSMMGIGSLIAIALLLISTID QTINRIWRCTNKRSRIQSFTIYWTILSLGPVIIGASLALSSYLFSVFQEHGSLSFGQRLL SLMPFILTWLTFAGVYTLVPHQRVSFRYALIGGLIAAILFFFGTDLFRLYITNFPSQQII YGALAVIPILFVWIYYSWLIVLIGAEVTATLEEFLKQQEDNNVTKEYLGADI
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Psychromonas ingrahamii UPF0761 membrane protein Ping_3482 and why is it significant for research?

Psychromonas ingrahamii UPF0761 membrane protein Ping_3482 is a membrane-associated protein from the extreme psychrophilic bacterium Psychromonas ingrahamii, which has the remarkable ability to grow at temperatures as low as -12°C . The protein belongs to the UPF0761 protein family, which consists of uncharacterized proteins with predicted membrane-spanning domains. The significance of Ping_3482 lies in its potential role in cold adaptation mechanisms that allow P. ingrahamii to function at extremely low temperatures.

The protein is available as a recombinant product expressed in E. coli, making it accessible for laboratory research . Genomic analysis of P. ingrahamii has revealed distinctive protein composition patterns that differ from mesophilic bacteria, with Ping_3482 potentially belonging to one of the six protein classes unique to this organism . Understanding the structure-function relationship of this protein could provide valuable insights into molecular mechanisms of cold adaptation, with potential applications in biotechnology, bioremediation in cold environments, and preservation of biological materials at low temperatures.

What are the structural characteristics and amino acid sequence of Ping_3482?

The Ping_3482 protein is a full-length protein consisting of 292 amino acids with the following amino acid sequence: MKFGRKIVMDKVKVTYQYLLFVWRRSEQDNIKVPAGHLAYVTLLSIVPLLAVIFYMLAAFPVFSDLKGMLEDLIYNNLLPTSGDTIQEHISGFIENTKKMSAMMGIGSLIAIALLLISTIDQTINRIWRCTNKRSRIQSFTIYWTILSLGPVIIGASLALSSYLFSVFQEHGSLSFGQRLLSLMPFILTWLTFAGVYTLVPHQRVSFRYALIGGLIAAILFFFGTDLFRLYITNFPSQQIIYGALAVIPILFVWIYYSWLIVLIGAEVTATLEEFLKQQEDNNVTKEYLGADI . The protein is classified as a membrane protein with predicted transmembrane domains, suggesting it is integrated into the cell membrane of P. ingrahamii.

What are the recommended storage and handling conditions for recombinant Ping_3482?

Recombinant Ping_3482 requires specific storage and handling conditions to maintain its structural integrity and functional properties. According to product information, the protein should be stored in a Tris-based buffer containing 50% glycerol, which is optimized specifically for this protein . The recommended storage temperature is -20°C for regular use, while long-term storage should be at -20°C or -80°C to prevent degradation.

Working aliquots should be stored at 4°C and used within one week to maintain optimal activity . It is explicitly advised to avoid repeated freezing and thawing cycles as this can lead to protein denaturation and loss of activity. When handling the protein, researchers should consider that as a protein from a psychrophilic organism, Ping_3482 may have unique temperature sensitivities different from mesophilic proteins. The presence of the His-tag in the recombinant version should be taken into account for experimental design, particularly for structural studies or when investigating protein-protein interactions.

What expression systems are used for producing recombinant Ping_3482?

Recombinant Ping_3482 is primarily produced using E. coli as the expression host, as indicated in product specifications . This heterologous expression system has been optimized to yield functional protein with a His-tag for purification purposes. The full-length protein (amino acids 1-292) is expressed, suggesting that the complete functional domains are preserved in the recombinant version.

When considering alternative expression systems, it's worth noting that other psychrophilic proteins, such as nucleases from P. ingrahamii, have been successfully expressed in eukaryotic systems like Pichia pastoris . This suggests that yeast expression systems might also be viable alternatives for Ping_3482 if specific post-translational modifications or folding environments are required. The choice of expression system should be guided by the intended experimental applications and the structural integrity needed for functional studies. For membrane proteins like Ping_3482, expression systems that can properly integrate membrane proteins may be particularly important, potentially requiring specialized strains or expression conditions to achieve proper folding and membrane insertion.

What experimental design approaches are most effective for studying the function of Ping_3482?

Designing experiments to elucidate the function of Ping_3482 requires a systematic approach that considers both the membrane-associated nature of the protein and its psychrophilic origin. A comprehensive experimental design should incorporate both in vitro and in vivo approaches, with careful control of variables that might affect protein function at different temperatures . Within-subjects design, where each experimental unit serves as its own control, may be particularly valuable when comparing protein function across temperature gradients to minimize variability from sources other than temperature .

A factorial design approach would allow researchers to systematically investigate interactions between multiple variables, such as temperature, pH, salt concentration, and potential binding partners . For membrane proteins like Ping_3482, reconstitution into liposomes or nanodiscs may be necessary to create a membrane-like environment for functional studies. Researchers should also consider the five key steps in experimental design: defining variables, writing testable hypotheses, designing treatments to manipulate independent variables, assigning subjects to groups, and planning measurement of dependent variables . Control of extraneous variables is particularly important when working with psychrophilic proteins, as temperature variations during purification and handling can significantly impact results.

Table 1: Experimental Design Framework for Ping_3482 Functional Studies

Design ComponentApproach for Ping_3482Considerations
Independent VariablesTemperature, pH, salt concentration, potential ligandsTest range from -12°C to 37°C to capture full temperature spectrum
Dependent VariablesBinding affinity, structural changes, enzymatic activity (if any)Multiple measurement techniques for validation
Control VariablesBuffer composition, protein concentration, time of incubationStandardize across all experimental conditions
TreatmentsTemperature gradients, potential binding partners, membrane compositionInclude both psychrophilic and mesophilic conditions
Measurement MethodsCircular dichroism, fluorescence spectroscopy, activity assaysEnsure methods function at low temperatures

How can comparative genomics be used to understand the evolutionary significance of Ping_3482?

Comparative genomics offers powerful insights into the evolutionary history and functional significance of Ping_3482 by analyzing its sequence conservation, genomic context, and phylogenetic relationships across bacterial species. The genomic analysis of P. ingrahamii revealed that it contains six classes of proteins based on compositional analysis, which is at least one more than other bacteria, suggesting unique protein adaptations to extreme cold . One approach is to identify orthologs of Ping_3482 in other psychrophiles and mesophiles to assess conservation patterns that might indicate functional importance.

The methodology should include sequence alignment of UPF0761 family proteins across diverse bacterial species, focusing on both cold-adapted and mesophilic organisms. Researchers should pay particular attention to conserved amino acid residues that might be critical for function, as well as substitutions specific to psychrophilic variants that could contribute to cold adaptation. Genomic context analysis, examining genes located near ping_3482 in the genome, might reveal functional associations through operonic structures or conserved gene neighborhoods. Protein clustering analysis, as performed by researchers studying the P. ingrahamii genome, can identify whether Ping_3482 belongs to one of the unique protein clusters found in this organism, particularly the cluster with a high proportion of "orphan" hypothetical proteins that might be cold-specific .

What analytical techniques are most appropriate for investigating the structure-function relationship of Ping_3482?

Investigating the structure-function relationship of Ping_3482 requires a multi-technique approach that can provide complementary information about both structural features and functional properties. For structural analysis, a combination of X-ray crystallography, cryo-electron microscopy, and nuclear magnetic resonance (NMR) spectroscopy would provide high-resolution structural information, although membrane proteins present significant challenges for crystallization. Circular dichroism (CD) spectroscopy can provide valuable information about secondary structure content and thermal stability, which is particularly relevant for a protein from an extreme psychrophile.

For investigating membrane interaction and topology, techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS), fluorescence spectroscopy with environment-sensitive probes, and oriented CD spectroscopy would be valuable. Functional characterization might include binding assays with potential ligands, assessment of potential enzymatic activities, and measurement of protein-protein interactions within membrane environments. Given the challenges of working with membrane proteins, incorporation of Ping_3482 into nanodiscs or liposomes might be necessary for many of these studies. Temperature-dependent studies are crucial, comparing protein behavior at temperatures ranging from -12°C (P. ingrahamii's growth temperature) to higher temperatures, to understand cold adaptation mechanisms .

Table 2: Analytical Techniques for Structure-Function Studies of Ping_3482

TechniqueInformation ProvidedSpecial Considerations for Ping_3482
Cryo-EMHigh-resolution structureSample preparation at low temperatures
CD SpectroscopySecondary structure, thermal stabilityTemperature range from -12°C to 37°C
HDX-MSSolvent accessibility, dynamicsMembrane protein sample preparation
Molecular Dynamics SimulationsDynamic behavior, membrane interactionsSimulation at low temperatures
Site-Directed MutagenesisFunctional roles of specific residuesExpression and purification of variants
Lipid Binding AssaysMembrane interaction specificityTemperature-dependent measurements

How does the amino acid composition of Ping_3482 contribute to cold adaptation mechanisms?

The amino acid composition of Ping_3482 likely plays a crucial role in its adaptation to functioning at extremely low temperatures, consistent with broader patterns observed in proteins from psychrophilic organisms. Genomic analysis of P. ingrahamii has revealed interesting compositional features, including a strong opposition between asparagine and the oxygen-sensitive amino acids methionine, arginine, cysteine, and histidine . This compositional bias might contribute to protein flexibility and stability at low temperatures.

The integral membrane proteins in P. ingrahamii, including potentially Ping_3482, show compositional features suggesting they may have a lower hydrophobic character compared to mesophilic counterparts . This characteristic could be crucial for maintaining membrane fluidity at extremely low temperatures, allowing continued function when membranes would otherwise become rigidified. Research approach to investigate this should include comparative analysis of the amino acid composition of Ping_3482 with homologous proteins from mesophilic organisms, focusing on differences in the proportions of hydrophobic residues, charged residues, and residues known to contribute to protein flexibility (glycine, serine).

Computational analysis of the protein sequence could predict regions of disorder or flexibility that might be important for function at low temperatures. Experimental validation could involve site-directed mutagenesis to modify specific residues predicted to be important for cold adaptation, followed by functional assays at different temperatures to assess the impact on protein stability and activity. Circular dichroism spectroscopy could be used to compare the thermal stability and unfolding characteristics of wild-type Ping_3482 and mutant variants, providing insights into the structural basis of cold adaptation.

What potential cellular functions might Ping_3482 perform in Psychromonas ingrahamii?

While the specific function of Ping_3482 remains uncharacterized (as indicated by its UPF0761 designation), several hypotheses can be formulated based on its membrane localization and the physiological requirements of an extreme psychrophile like P. ingrahamii. As a membrane protein, Ping_3482 could potentially function in transport processes, signaling, membrane stabilization, or enzymatic activities associated with the cell envelope. The extreme cold adaptation of P. ingrahamii suggests that membrane proteins like Ping_3482 must maintain functionality at temperatures where membrane fluidity is significantly reduced.

Genomic analysis of P. ingrahamii has revealed several notable features that might provide context for Ping_3482's function, including a large number of regulators of cyclic GDP suggesting extensive extracellular polysaccharide production that may help sequester water or lower freezing points near the cell . Additionally, P. ingrahamii possesses numerous (11) three-subunit TRAP systems that may play crucial roles in nutrient transport at low temperatures . Investigation into whether Ping_3482 might be associated with these transport systems would be a valuable research direction. The presence of genes for osmolyte production (betaine choline) to balance osmotic pressure in freezing sea ice also suggests potential roles in cellular adaptation to freeze-thaw cycles .

Experimental approaches to determine Ping_3482's function might include gene knockout or knockdown studies in P. ingrahamii (if genetic tools are available), or heterologous expression in model organisms with subsequent phenotypic analysis. Protein-protein interaction studies, such as pull-down assays or proximity labeling approaches, could identify binding partners that might provide functional clues. Localization studies using fluorescently tagged versions of the protein could reveal subcellular distribution patterns that might correlate with specific functions.

How can site-directed mutagenesis be used to investigate the structure-function relationship of Ping_3482?

Site-directed mutagenesis represents a powerful approach to systematically investigate the structure-function relationship of Ping_3482 by allowing researchers to make specific, targeted changes to the protein sequence and assess their impact on function. For a membrane protein like Ping_3482, mutagenesis studies should prioritize residues predicted to be involved in membrane interactions, potential binding sites, or residues unique to psychrophilic variants of the protein. The experimental design should include a systematic approach to selecting target residues based on sequence conservation analysis, structural predictions, and comparative analysis with homologous proteins .

A comprehensive mutagenesis strategy might include: (1) Alanine scanning of conserved residues to identify those critical for function; (2) Conservative substitutions to investigate the importance of specific chemical properties; (3) Introduction of residues found in mesophilic homologs to test their impact on cold adaptation; and (4) Mutation of residues unique to psychrophilic variants to assess their contribution to cold functionality. For each mutant, researchers should assess protein expression, stability, localization, and functional properties across a range of temperatures from -12°C to 37°C to fully capture temperature-dependent effects .

Analysis of mutant phenotypes should employ multiple methodologies to comprehensively characterize changes in protein behavior. Circular dichroism spectroscopy can assess changes in secondary structure and thermal stability. Fluorescence spectroscopy with environment-sensitive probes can detect changes in protein conformation or ligand binding. Functional assays specific to the hypothesized role of Ping_3482 (e.g., transport, signaling, enzymatic activity) should be performed at different temperatures. The integration of results from these analyses would provide insights into which residues are critical for function, which contribute to cold adaptation, and which might be involved in specific molecular interactions.

What are the challenges and solutions in purifying and working with recombinant membrane proteins from psychrophilic organisms?

Working with membrane proteins from psychrophilic organisms presents unique challenges that require specialized approaches for successful purification and functional characterization. Membrane proteins are inherently difficult to work with due to their hydrophobic nature and requirement for a lipid environment, and these challenges are compounded when dealing with proteins adapted to function at extremely low temperatures. The main challenges include: maintaining protein stability during extraction and purification, preserving native conformation and function, and establishing appropriate experimental conditions that reflect the protein's natural environment .

To address these challenges, researchers can employ several strategies specific to psychrophilic membrane proteins. For extraction, detergent screening is crucial to identify conditions that efficiently solubilize the protein while preserving its native state, with milder detergents often being preferable for preserving function. All purification steps should be performed at reduced temperatures (4°C or lower if possible) to maintain protein stability, but not so low as to cause detergent precipitation. Alternative approaches to traditional detergent-based methods include the use of styrene-maleic acid lipid particles (SMALPs) or nanodiscs, which extract membrane proteins with their surrounding lipid environment intact, potentially better preserving native conformation.

For functional studies, reconstitution into liposomes composed of lipids similar to those found in psychrophilic membranes may provide a more native-like environment than detergent micelles. Temperature control during experiments is critical, with measurements performed across a range of temperatures to understand temperature-dependent behavior. The choice of buffer components should also be considered, as salt concentration and pH optima may differ between psychrophilic and mesophilic proteins. Finally, storage conditions should be optimized to maintain long-term stability, with the addition of stabilizing agents such as glycerol (as recommended for Ping_3482) .

How might understanding Ping_3482 contribute to biotechnological applications involving cold-active proteins?

Understanding the structure, function, and cold-adaptation mechanisms of Ping_3482 could significantly advance biotechnological applications that require protein activity at low temperatures. Cold-active proteins offer numerous advantages in industrial and research applications, including energy savings through low-temperature processes, activity in cold environments, and higher specific activity that can compensate for slower reaction rates at reduced temperatures. Membrane proteins like Ping_3482 might have particular applications in areas requiring membrane-associated functions at low temperatures, such as biosensors, bioremediation in cold environments, or cold-stable membrane systems for biotechnology.

Psychrophilic enzymes from P. ingrahamii have already demonstrated biotechnological potential, as exemplified by the characterization of a nuclease (PinNuc) that shows activity at room temperature in low ion-strength buffers . Similar applications might be possible for Ping_3482 if functional characterization reveals enzymatic activity or other biotechnologically useful properties. The ability of P. ingrahamii to grow at temperatures as low as -12°C suggests that its proteins, including Ping_3482, possess extreme cold-adaptation features that might be transferable to other proteins through protein engineering approaches.

Research directions that could lead to biotechnological applications include: (1) Detailed structural and functional characterization to identify cold-adaptation features that could be applied to other proteins; (2) Investigation of potential enzymatic activities that might be useful in low-temperature bioprocesses; (3) Exploration of the protein's stability in organic solvents or other non-conventional media that might be useful for biocatalysis; and (4) Development of expression systems optimized for the production of functional psychrophilic membrane proteins for research and industrial applications.

What experimental approaches can determine if Ping_3482 interacts with other proteins in cold adaptation pathways?

Identifying protein-protein interactions involving Ping_3482 requires specialized approaches that account for both its membrane localization and psychrophilic nature. A comprehensive strategy would involve both in vivo and in vitro methods to capture physiologically relevant interactions while minimizing artifacts. In vivo approaches might include proximity labeling methods such as BioID or APEX, where a promiscuous biotin ligase or peroxidase is fused to Ping_3482, allowing biotinylation of proteins in close proximity within the native cellular environment of P. ingrahamii .

Co-immunoprecipitation coupled with mass spectrometry (Co-IP-MS) could identify stable interaction partners, though careful optimization of detergent conditions would be necessary to maintain membrane protein complexes. Two-hybrid systems adapted for membrane proteins, such as the split-ubiquitin system, could screen for potential interactors in a heterologous host. For direct physical interaction studies, techniques such as surface plasmon resonance (SPR) or microscale thermophoresis (MST) could be used with purified Ping_3482 and candidate interaction partners, with experiments conducted across a range of temperatures to identify cold-dependent interactions .

Computational approaches can complement experimental methods by predicting potential interaction partners based on genomic context, co-expression patterns, or structural complementarity. The genomic analysis of P. ingrahamii has already identified several systems potentially involved in cold adaptation, including TRAP transporters and regulators of extracellular polysaccharide production . Cross-linking studies followed by mass spectrometry could capture transient interactions within the membrane environment. Each of these approaches has strengths and limitations, so a combination of multiple methods would provide the most comprehensive and reliable identification of Ping_3482 interaction partners.

How does the study of Ping_3482 contribute to our understanding of extremophile adaptation mechanisms?

The study of Ping_3482 provides a valuable model for understanding broader principles of protein adaptation to extreme environments, particularly the molecular mechanisms underlying psychrophily. P. ingrahamii represents one of the most extreme cases of cold adaptation among characterized bacteria, with the ability to grow exponentially at -12°C . As a membrane protein from this organism, Ping_3482 must function within a cellular environment where membrane fluidity, solute diffusion, and enzyme kinetics are severely challenged by low temperatures.

Comparative analysis of Ping_3482 with homologous proteins from mesophilic and thermophilic organisms can reveal adaptation strategies at the sequence and structural levels. The genomic analysis of P. ingrahamii has already indicated unique protein compositional features, including six classes of proteins (at least one more than other bacteria) and distinctive patterns in amino acid usage that may reflect adaptation to oxidative stress at low temperatures . These findings suggest that proteins like Ping_3482 may employ novel strategies for maintaining function in extreme cold.

The insights gained from studying Ping_3482 extend beyond understanding a single protein to illuminate fundamental principles of protein evolution and adaptation. These principles may be applicable to other extreme environments, contributing to our understanding of the limits of life on Earth and potential adaptations in extraterrestrial environments. From a practical perspective, understanding the molecular basis of cold adaptation in proteins like Ping_3482 could inform protein engineering efforts to develop cold-active enzymes for biotechnological applications, design more stable proteins for various applications, and develop strategies for preserving protein function in extreme conditions.

What are the key knowledge gaps and future research priorities for understanding Ping_3482?

Despite the availability of recombinant Ping_3482 and information about its amino acid sequence and classification, significant knowledge gaps remain that should drive future research priorities. The most fundamental gap is the lack of functional characterization – the specific biological role of Ping_3482 in P. ingrahamii remains unknown, as indicated by its designation as an uncharacterized protein family (UPF0761). The three-dimensional structure of Ping_3482 has not been determined, limiting our understanding of how its structural features contribute to function and cold adaptation. The potential interactions between Ping_3482 and other cellular components, including proteins, lipids, or other biomolecules, are largely unexplored.

Future research priorities should address these gaps through a multidisciplinary approach combining structural biology, biochemistry, molecular biology, and biophysics. High-priority research directions include: (1) Structural determination through X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy; (2) Functional characterization through genetic approaches (gene knockout, overexpression) and biochemical assays; (3) Identification of interaction partners through proteomics and protein-protein interaction studies; (4) Investigation of temperature-dependent properties through biophysical characterization across temperature ranges; and (5) Comparative studies with homologous proteins from mesophilic organisms to identify cold-adaptation features.

These research priorities should be pursued with consideration of the unique challenges posed by studying proteins from extremophiles, particularly the need to work at non-standard temperatures and to develop specialized experimental approaches. Collaborative efforts combining expertise in membrane protein biochemistry, extremophile biology, structural biology, and protein evolution would be most effective in addressing these complex questions. The insights gained would not only elucidate the specific properties and functions of Ping_3482 but also contribute to our broader understanding of protein adaptation to extreme environments.

How can researchers effectively design experiments to compare Ping_3482 with homologous proteins from mesophilic organisms?

A comprehensive comparative study should examine multiple parameters across a range of temperatures (from -12°C to 37°C or higher) to capture the full spectrum of temperature-dependent behavior. This approach would allow identification of temperature optima and ranges for different proteins and determination of whether cold adaptation involves shifts in these optima or changes in absolute performance. Control variables must be carefully standardized, including buffer composition, protein concentration, and experimental conditions, to ensure that observed differences are attributable to intrinsic protein properties rather than experimental artifacts.

To minimize bias and ensure reproducibility, experimental design should incorporate randomization, adequate replication, and appropriate statistical analysis methods. A factorial design approach would be particularly valuable, allowing systematic investigation of interactions between protein source and variables such as temperature, pH, and salt concentration . When possible, multiple measurement techniques should be used to assess each parameter of interest, providing complementary data and reducing the risk of technique-specific artifacts. Finally, the results should be interpreted in the context of the natural environments and physiological roles of the proteins being compared, recognizing that adaptation may involve trade-offs between different performance parameters.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.