Recombinant Pteropus scapulatus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

What is MT-ND4L and what is its role in mitochondrial function?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a mitochondrially-encoded subunit of Complex I of the electron transport chain. This protein functions as part of the NADH dehydrogenase complex (EC 1.6.5.3) and is essential for the initial steps of electron transfer from NADH to the respiratory chain. The protein consists of 98 amino acids in Pteropus scapulatus, with a full sequence of MALTYMNNMALALFTVSLGLLMYRSHLMSSLLCLEGMMLSLFVTMALTILNSNLVLASMIP IILLVFAACEAALGLSLLVMVSNTYGVDHVQNLNLLQC . As a hydrophobic membrane protein, MT-ND4L is integrated into the inner mitochondrial membrane where it participates in proton pumping activities essential for ATP synthesis. Understanding its function provides insights into mitochondrial energy production and potential implications for mitochondrial-related disorders.

How does recombinant Pteropus scapulatus MT-ND4L differ from native protein?

Recombinant Pteropus scapulatus MT-ND4L proteins can be produced with various tag systems, which are determined during the manufacturing process according to experimental needs . The recombinant version is typically supplied as a lyophilized powder with >85% purity as confirmed by SDS-PAGE analysis . Unlike the native protein, which exists in a membrane-bound complex with other mitochondrial proteins, recombinant versions may lack post-translational modifications that occur in vivo. Additionally, recombinant MT-ND4L can be produced as full-length or partial proteins depending on the expression system and research requirements. For accurate structure-function studies, researchers should consider these differences and validate whether the recombinant protein recapitulates key properties of the native form, including proper folding, oligomeric state, and enzymatic activity.

What expression systems are available for recombinant MT-ND4L production?

Several expression systems are available for producing recombinant Pteropus scapulatus MT-ND4L, each with specific advantages for different research applications:

• E. coli expression system (product codes: CSB-EP875577PMAF1): Provides high yield and cost-effectiveness, suitable for structural studies and applications not requiring post-translational modifications .

• Yeast expression system (product code: CSB-YP875577PMAF1): Offers eukaryotic post-translational modifications and proper protein folding, beneficial for functional studies .

• Baculovirus expression system (product code: CSB-BP875577PMAF1): Delivers higher-order eukaryotic protein modifications and is particularly useful for membrane proteins like MT-ND4L .

• Mammalian cell expression system (product code: CSB-MP875577PMAF1): Provides the most authentic post-translational modifications and protein folding, closest to native protein properties .

• Biotinylated versions (e.g., CSB-EP875577PMAF1-B): Available with Avi-tag biotinylation, where E. coli biotin ligase (BirA) catalyzes amide linkage between biotin and the specific lysine of the AviTag, useful for protein interaction studies and immobilization applications .

The selection of an appropriate expression system should be based on the specific research requirements, including protein yield, post-translational modifications, and downstream applications.

How does POLRMT overexpression affect mitochondrial gene expression and MT-ND4L transcription?

Recent research on mitochondrial RNA polymerase (POLRMT) overexpression provides insights relevant to MT-ND4L transcription regulation. Studies with POLRMT-overexpressing mice have demonstrated a significant increase (~50%) in de novo mitochondrial transcription without corresponding increases in steady-state transcript levels . This suggests complex post-transcriptional regulation that would also affect MT-ND4L expression. The discrepancy between elevated transcription rates and unchanged steady-state transcript levels indicates that post-transcriptional processes, including RNA processing and stability, may be rate-limiting rather than transcription initiation. Additionally, POLRMT overexpression resulted in increased mtDNA levels (~17%) without changes in TFAM, TWINKLE, or SSBP1 protein levels . This suggests a decreased TFAM-to-mtDNA ratio, potentially resulting in less compacted mtDNA and increased accessibility for transcription machinery. For MT-ND4L research, these findings imply that modulating transcription initiation alone may not be sufficient to alter steady-state protein levels, highlighting the importance of investigating post-transcriptional mechanisms in mitochondrial gene expression studies.

What methodological approaches can resolve contradictions in MT-ND4L functional studies?

Contradictory findings in MT-ND4L functional studies can arise from several methodological variations. To resolve such contradictions, researchers should implement a comprehensive approach:

• Standardize protein preparation: Different expression systems (E. coli, yeast, baculovirus, mammalian cells) yield MT-ND4L proteins with varying post-translational modifications and folding characteristics . Direct comparison studies using MT-ND4L from multiple expression systems can help identify system-specific artifacts.

• Validate protein integrity: Before functional assays, confirm protein identity and integrity using mass spectrometry, circular dichroism, and activity assays against established controls. The amino acid sequence MALTYMNNMALALFTVSLGLLMYRSHLMSSLLCLEGMMLSLFVTMALTILNSNLVLASMIP IILLVFAACEAALGLSLLVMVSNTYGVDHVQNLNLLQC should be verified .

• Reconstitution conditions: For membrane proteins like MT-ND4L, the lipid environment significantly affects function. Systematically vary lipid composition, protein-to-lipid ratios, and reconstitution methods to identify optimal conditions that produce consistent results.

• Control for mitochondrial context: Studies of isolated MT-ND4L versus its function within Complex I may yield different results. When possible, conduct parallel experiments using both approaches and reconcile findings through structural and functional analyses.

• Implement multi-laboratory validation: Contradictory results often reflect laboratory-specific variables. Collaborative studies across multiple laboratories using standardized protocols can identify robust, reproducible findings versus technique-dependent artifacts.

These approaches can help researchers distinguish genuine biological complexity from methodological variability in MT-ND4L functional studies.

How can I design experiments to study the role of MT-ND4L in mitochondrial disease models?

Designing experiments to study the role of recombinant Pteropus scapulatus MT-ND4L in mitochondrial disease models requires a systematic approach:

• Cross-species comparative analysis: Compare MT-ND4L sequence and function across species, particularly between Pteropus scapulatus and human variants. The conserved regions likely represent functionally critical domains. The full amino acid sequence from Pteropus scapulatus can serve as a reference point for such comparisons .

• Disease-associated mutation modeling: Introduce disease-associated mutations from human MT-ND4L into the recombinant Pteropus scapulatus protein using site-directed mutagenesis. Test these mutant proteins for altered function using:

  • Electron transfer assays

  • ROS production measurements

  • Membrane potential assessments

  • Protein-protein interaction studies

• Cellular model development: Develop cellular models with either:

  • Depleted endogenous MT-ND4L (using CRISPR/Cas9 if nuclear-encoded versions exist)

  • Introduced mutant MT-ND4L

  • Complementation with wild-type or recombinant versions

• Functional readouts: Measure multiple parameters including:

  • Oxygen consumption rates

  • ATP production

  • ROS generation

  • Mitochondrial membrane potential

  • Cell viability under various stressors

• Integration with -omics approaches: Combine functional studies with proteomics, metabolomics, and transcriptomics to capture the broader impact of MT-ND4L alterations on cellular physiology.

This experimental framework allows for systematic investigation of MT-ND4L's role in mitochondrial disease while controlling for variables that could confound interpretation.

What are the optimal storage and handling conditions for recombinant MT-ND4L?

Proper storage and handling of recombinant Pteropus scapulatus MT-ND4L is critical for maintaining protein integrity and function. The recommended conditions are:

• Long-term storage: Store at -20°C for standard preservation, or -80°C for extended storage periods . The protein is typically provided in a storage buffer containing Tris-based buffer with 50% glycerol, which has been optimized for this specific protein .

• Working aliquots: For ongoing experiments, working aliquots can be stored at 4°C for up to one week . This minimizes freeze-thaw cycles that can degrade protein quality.

• Reconstitution procedure: Briefly centrifuge the vial prior to opening to bring contents to the bottom of the tube. Reconstitute the lyophilized powder in the appropriate buffer based on downstream applications .

• Freeze-thaw considerations: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity . Instead, prepare small working aliquots from the stock solution.

• Handling precautions: As a hydrophobic membrane protein, MT-ND4L may be prone to aggregation. Consider adding mild detergents or lipid nanodiscs for experiments requiring solubilized protein.

Following these storage and handling guidelines will help ensure experimental reproducibility and maximize the functional activity of recombinant MT-ND4L preparations.

How can I validate the purity and functionality of recombinant MT-ND4L?

Validating both purity and functionality of recombinant Pteropus scapulatus MT-ND4L requires a multi-faceted approach:

Purity Assessment:

• SDS-PAGE: Commercial preparations should show >85% purity by SDS-PAGE . Run your sample alongside a known standard to confirm molecular weight and purity.

• Western Blot: Use specific antibodies against MT-ND4L or any fusion tags to confirm identity and assess potential degradation products.

• Mass Spectrometry: For highest confidence, perform LC-MS/MS analysis to confirm the amino acid sequence matches the expected sequence (MALTYMNNMALALFTVSLGLLMYRSHLMSSLLCLEGMMLSLFVTMALTILNSNLVLASMIP IILLVFAACEAALGLSLLVMVSNTYGVDHVQNLNLLQC) .

Functionality Validation:

• NADH Dehydrogenase Activity Assay: Measure the rate of NADH oxidation in the presence of appropriate electron acceptors. Compare activity to established controls or native Complex I preparations.

• Reconstitution Experiments: Assess whether the recombinant protein can incorporate into membrane systems or complementdeplete systems lacking MT-ND4L.

• Protein-Protein Interaction Analysis: Verify interactions with known binding partners using techniques such as co-immunoprecipitation, proximity ligation assays, or pull-down experiments.

• Antibody Recognition: Confirm recognition by specific antibodies in both denatured (Western blot) and non-denatured (ELISA) conditions .

For tagged variants, such as biotinylated versions with Avi-tag, additional validation of tag functionality (e.g., streptavidin binding for biotinylated proteins) should be performed .

What controls should be included in MT-ND4L experimental designs?

Robust experimental design for studies involving recombinant Pteropus scapulatus MT-ND4L should include the following controls:

Negative Controls:

• Buffer-only control: To establish baseline measurements and account for buffer components effects.

• Heat-denatured MT-ND4L: To distinguish between specific protein activity and non-specific effects.

• Non-relevant protein of similar size/properties: To control for general protein effects versus MT-ND4L-specific effects.

Positive Controls:

• Native Complex I preparations: To benchmark recombinant MT-ND4L activity against physiological standards.

• Well-characterized MT-ND4L from model organisms: To compare cross-species functional conservation.

Procedural Controls:

• Expression system background: When using heterologous expression systems, include extracts from the expression host without the MT-ND4L gene to control for host contaminants.

• Tag-only proteins: For tagged versions of MT-ND4L, include controls with the tag alone to distinguish tag-mediated effects.

• Dose-response validation: Perform activity measurements across a range of protein concentrations to establish linearity and specificity of response.

Validation Controls:

• Multiple detection methods: Verify key findings using complementary techniques (e.g., spectrophotometric assays, oxygen consumption, membrane potential measurements).

• Inhibitor controls: Use specific inhibitors of Complex I (like rotenone) to confirm that measured activities are on-target.

How can I optimize the incorporation of recombinant MT-ND4L into functional studies of mitochondrial respiration?

Optimizing the incorporation of recombinant Pteropus scapulatus MT-ND4L into functional studies requires addressing its hydrophobic nature and proper integration into respiratory complexes:

• Membrane reconstitution strategies:

  • Liposome reconstitution: Incorporate purified MT-ND4L into liposomes of varying lipid compositions to identify optimal membrane environments.

  • Nanodiscs: Use membrane scaffold proteins to create defined lipid environments for MT-ND4L incorporation and functional studies.

  • Proteoliposomes: Co-reconstitute MT-ND4L with other Complex I subunits to study functional interactions.

• Expression system selection:

  • Different expression systems (yeast, E. coli, baculovirus, mammalian cells) provide varying levels of post-translational modifications and folding environments .

  • For optimal functionality, mammalian cell expression systems often provide the most native-like protein characteristics for mitochondrial proteins .

• Respiratory chain integration assessment:

  • Complementation assays: Introduce recombinant MT-ND4L into systems with deleted or mutated endogenous MT-ND4L and measure respiratory rescue.

  • Blue native PAGE: Assess incorporation of MT-ND4L into higher-order Complex I assemblies.

  • Activity coupling: Measure sequential electron transfer through reconstituted systems containing MT-ND4L.

• Experimental conditions optimization:

  • Buffer composition: Systematic testing of ionic strength, pH, and specific ions (Mg²⁺, Ca²⁺) for optimal activity.

  • Temperature sensitivity: Determine optimal temperature ranges for MT-ND4L function, considering the physiological temperature of the source organism.

  • Substrates and cofactors: Titrate NADH and other electron carriers to determine optimal concentrations for measuring MT-ND4L-dependent activities.

These approaches help ensure that recombinant MT-ND4L retains native-like functionality in experimental systems.

What are the most sensitive techniques for detecting MT-ND4L interactions with other mitochondrial proteins?

Several advanced techniques offer high sensitivity for detecting interactions between recombinant Pteropus scapulatus MT-ND4L and other mitochondrial proteins:

• Proximity-based approaches:

  • Bioluminescence Resonance Energy Transfer (BRET): Tag MT-ND4L with a luciferase donor and potential interaction partners with fluorescent acceptors. Interaction brings tags into proximity, enabling energy transfer.

  • Förster Resonance Energy Transfer (FRET): Similar principle to BRET but using fluorescent donors and acceptors, allowing visualization of interactions in live cells.

  • Proximity Ligation Assay (PLA): Detect protein interactions at endogenous expression levels with high sensitivity through antibody-based recognition and rolling circle amplification.

• Biochemical approaches:

  • Co-immunoprecipitation with crosslinking: Use membrane-permeable crosslinkers to stabilize transient interactions before cell lysis and immunoprecipitation.

  • Chemical crosslinking coupled to mass spectrometry (XL-MS): Identify interaction interfaces with amino acid resolution by crosslinking followed by proteomic analysis.

  • Biotinylated MT-ND4L variants (such as CSB-EP875577PMAF1-B) allow for streptavidin-based pull-down assays with minimal interference to protein structure .

• Structural approaches:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Map interaction surfaces by measuring differences in hydrogen-deuterium exchange rates between free and complexed proteins.

  • Cryo-Electron Microscopy: Visualize MT-ND4L complexes at near-atomic resolution, particularly effective for membrane protein complexes.

• Functional interaction assays:

  • Activity coupling assays: Measure changes in enzymatic activity upon addition of potential interaction partners.

  • Membrane potential measurements: Assess functional consequences of MT-ND4L interactions on proton pumping efficiency.

These techniques vary in sensitivity, resolution, and suitability for membrane proteins, but together provide comprehensive tools for characterizing MT-ND4L interactions.

How can I troubleshoot inconsistent results in MT-ND4L functional assays?

Inconsistent results in functional assays with recombinant Pteropus scapulatus MT-ND4L often stem from specific technical challenges related to this membrane protein. The following systematic troubleshooting approach can help resolve these issues:

Problem: Loss of activity during storage

• Solution: Verify storage conditions match recommendations: -20°C for standard storage, -80°C for extended periods .

• Test: Compare fresh preparations with stored samples using standardized activity assays.

• Prevention: Aliquot proteins to avoid repeated freeze-thaw cycles, add glycerol (50%) as cryoprotectant .

Problem: Variable activity between protein batches

• Solution: Implement rigorous quality control for each batch using SDS-PAGE (>85% purity standard) .

• Test: Run parallel assays with different batches and a consistent positive control.

• Prevention: Standardize expression and purification protocols, possibly using automated systems.

Problem: Activity declines during experiments

• Solution: Check for protein aggregation by dynamic light scattering or analytical ultracentrifugation.

• Test: Monitor activity over time under experimental conditions.

• Prevention: Optimize buffer conditions (detergents, lipids) to maintain protein stability during experiments.

Problem: Non-reproducible interaction studies

• Solution: Verify protein orientation and accessibility in membrane or detergent systems.

• Test: Use multiple complementary interaction detection methods.

• Prevention: Consider using oriented systems (e.g., supported bilayers) or specific tags that ensure correct orientation .

Problem: No detectable activity

• Solution: Confirm protein folding using circular dichroism or fluorescence spectroscopy.

• Test: Try multiple activity assay formats with varying sensitivity.

• Prevention: Express the protein in different systems (yeast, E. coli, baculovirus, mammalian) to identify optimal expression conditions .

This systematic approach allows researchers to identify and address specific factors causing inconsistency in MT-ND4L functional assays.

How should I interpret MT-ND4L activity data in the context of whole mitochondrial function?

Interpreting MT-ND4L activity data requires careful consideration of its role within the broader context of mitochondrial function:

What statistical approaches are best suited for analyzing MT-ND4L experimental data?

Selecting appropriate statistical methods for MT-ND4L experimental data requires consideration of experimental design complexity and data characteristics:

• For comparing MT-ND4L activity across conditions:

  • For normally distributed data from multiple treatment groups: One-way ANOVA followed by appropriate post-hoc tests (Tukey's HSD for all pairwise comparisons or Dunnett's test for comparisons against a control).

  • For non-normally distributed data: Kruskal-Wallis test followed by Dunn's post-hoc test.

  • For repeated measures designs: Repeated measures ANOVA or mixed-effects models to account for within-subject correlations.

• For dose-response relationships:

  • Nonlinear regression analysis to estimate EC50/IC50 values and Hill coefficients.

  • Comparison of dose-response curves across conditions using extra sum-of-squares F test.

  • Evaluation of ceiling and floor effects that may indicate secondary mechanisms.

• For multivariate data analysis (when measuring multiple mitochondrial parameters):

  • Principal Component Analysis (PCA) to identify patterns of covariation among variables and reduce dimensionality.

  • Partial Least Squares Discriminant Analysis (PLS-DA) to identify variables most strongly associated with experimental conditions.

  • Hierarchical clustering to identify natural groupings in complex datasets.

• For integrating MT-ND4L data with other -omics data:

  • Pathway enrichment analysis to identify biological processes affected by MT-ND4L alterations.

  • Network analysis to map relationships between MT-ND4L and interacting proteins or processes.

  • Multi-omics integration approaches like Similarity Network Fusion or MOFA (Multi-Omics Factor Analysis).

• For time-course experiments:

  • Repeated measures ANOVA with time as within-subject factor.

  • Mixed-effects models with random intercepts/slopes to account for individual variation.

  • Time series analysis methods for detecting cyclical patterns or delayed responses.

These approaches provide robust frameworks for extracting meaningful insights from complex MT-ND4L experimental data while accounting for various sources of variation.