Recombinant PTS system mannitol-specific EIICB component (mtlA)

Shipped with Ice Packs
In Stock

Description

Regulatory Mechanisms

mtlA expression is tightly regulated by species-specific transcriptional factors:

A. Vibrio cholerae: MtlR as a Repressor

  • Role: MtlR negatively regulates mtlA transcription, particularly in non-mannitol environments. Overexpression of MtlR inhibits growth on mannitol and biofilm formation .

  • Expression Dynamics: MtlR levels peak in mannitol medium and persist during environmental transitions, suggesting a role in calibrating mtlA expression .

B. Lactococcus lactis: MtlR as an Activator

  • Role: MtlR functions as a transcriptional activator. Deleting mtlF (EIICB partner) enhances mtlA expression, indicating a phosphorylation-dependent regulatory loop .

  • Industrial Relevance: Overexpression of mtlR and mtlD (mannitol-1-phosphate dehydrogenase) in L. lactis achieves 10.1 g/L mannitol with 55% yield, the highest reported for this organism .

Transport vs. Phosphorylation Specificity

  • E. coli Mutants: Mutations in mtlA (e.g., Gly-253→Glu) disrupt transport but retain phosphorylation activity, confirming domain-specific functions .

  • Kinetic Behavior: Mutant EIICB variants exhibit altered substrate affinity and thermolability, underpinning structural determinants of transport efficiency .

Biofilm Formation and Pathogenicity

  • V. cholerae: MtlA-mediated mannitol transport promotes biofilm formation, a critical virulence factor .

  • S. mutans: mtlA is linked to dental caries via mannitol fermentation, producing lactic acid .

Industrial Mannitol Production

  • Operon Engineering: In L. lactis, splitting the mtlA-mtlF-mtlD operon and optimizing mtlD expression enhances mannitol yield .

Key Research Gaps

  1. Domain-Specific Functions: The role of duplicated EIIB-like regions in S. mutans mtlA remains unclear .

  2. Cross-Species Regulation: Contrasting roles of MtlR (repressor vs. activator) necessitate comparative studies .

  3. Thermodynamic Properties: Detailed thermodynamic profiles of mtlA mutants could inform transporter engineering.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. Should you have a specific tag type preference, please inform us, and we will prioritize development according to your requirements.
Synonyms
mtlA; SP_0394; PTS system mannitol-specific EIICB component; EIICB-Mtl; EII-Mtl [Includes: Mannitol permease IIC component; PTS system mannitol-specific EIIC component; Mannitol-specific phosphotransferase enzyme IIB component; PTS system mannitol-specific EIIB component]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Target Names
mtlA
Target Protein Sequence
MEEKVSLKVRVQKLGTSLSNMVMPNIGAFIAWGVLTALFIADGYLPNEQLATVVGPMLTY LLPILIGYTGGYMIHGQRGAVVGAIATVGAITGSSVPMFIGAMVMGPLGGWTIKKFDEKF QEKIRPGFEMLVNNFSAGLVGFALLLLAFYAIGPVVSTLTGAVGNGVEAIVNARLLPMAN IIIEPAKVLFLNNALNHGIFTPLGVEQVAQAGKSILFLLEANPGPGLGILLAYAVFGKGS AKSSSWGAMVIHFFGGIHEIYFPYVMMKPTLFLAAMAGGISGTFTFQLLDAGLKSPASPG SIIAIIATAPKGVWPHLNVLLGVLVAAVVSFLVAALILHADKSTEDSLEAAQAATQAAKA QSKGQLVSTSVDAVVSTDSVEKIIFACDAGMGSSAMGASILRDKVKKAGLEIPVSNQAIS NLLDTPKTLIVTQEELTPRAKDKSPSAIHVSVDNFLASSRYDEIVASLTGASPIAEIEGD IPTSAPVDSQESDLNHIDAVVVAYGKAQGTATMGCETIRAIFRNKNIRIPVSTAKISELG EFNSKNIMIVTTISLQAEVQQAAPNSQFLIVDSLVTTPEYDKMAARMYK
Uniprot No.

Target Background

Function
The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a primary carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates simultaneously with their translocation across the cell membrane. The enzyme II CmtAB PTS system plays a role in the transport of D-mannitol.
Database Links

KEGG: spn:SP_0394

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the PTS system mannitol-specific EIICB component (mtlA)?

The mtlA gene encodes the mannitol-specific Enzyme II (EII) component of the phosphoenolpyruvate-dependent phosphotransferase system (PTS). It is a critical component for mannitol transport in bacterial species such as Streptococcus mutans. The gene product consists of 589 amino acids with a molecular mass of approximately 62.0 kDa in S. mutans . The protein functions as part of the bacterial carbohydrate transport mechanism, which is essential for nutrient acquisition and metabolism. Specifically, mtlA contains the EIICB domains of the PTS, while in some organisms, the EIIA domain is part of a separate gene (mtlF) .

How does mtlA differ between bacterial species?

The mtlA protein exhibits similarity across different bacterial species, but with notable structural variations. In Streptococcus mutans, the similarity with mtlA proteins from other organisms is generally restricted to the 470 amino-terminal residues, corresponding to the EIICB domains . Unlike some bacteria where all EII domains (EIIA, EIIB, and EIIC) are fused to form a single molecule, S. mutans has separated domains. The genes encoding the EIICB (mtlA) and EIIA (mtlF) domains are separated by approximately 2250 bp in the S. mutans genome . This genomic organization differs from that seen in Escherichia coli, where the mtlF gene product shows 76.6% similarity to the carboxyl-terminal 143 amino acids of the E. coli mtlA product .

What are the key considerations when designing experiments involving recombinant mtlA proteins?

When designing experiments with recombinant mtlA proteins, researchers should follow these methodological considerations:

  • Variable identification: Define your independent variables (e.g., expression conditions, purification methods) and dependent variables (e.g., protein activity, binding affinity) clearly before starting .

  • Hypothesis formulation: Develop a specific, testable hypothesis about mtlA function or structure .

  • Controls: Include appropriate positive and negative controls to validate experimental results. For mtlA studies, consider using known functional mutants or related proteins with different specificities .

  • Storage conditions: Store recombinant mtlA at -20°C, or at -80°C for extended storage. Avoid repeated freezing and thawing, and consider keeping working aliquots at 4°C for up to one week .

  • Expression system selection: Choose an expression system appropriate for your research question. Both E. coli and yeast expression systems have been used successfully for mtlA proteins from various bacterial species .

What experimental designs are suitable for studying mtlA functionality?

Depending on your research questions about mtlA, several experimental design approaches may be appropriate:

  • Randomized Controlled Trials (RCTs): For comparing different mtlA variants or testing interventions that affect mtlA function, RCTs with careful randomization of samples can be used .

  • Factorial Designs: When investigating how multiple factors (e.g., temperature, pH, substrate concentration) affect mtlA activity, factorial designs allow for efficient testing of variable interactions .

  • Sequential Multiple Assignment Randomized Trial (SMART): For optimizing experimental conditions or treatment sequences for mtlA expression or purification, SMART designs can help determine the optimal sequence of steps .

  • Interrupted Time Series (ITS): When studying the effects of mtlA expression over time or under changing conditions, ITS designs can track longitudinal changes while controlling for time-varying confounders .

How can researchers effectively express and purify functional recombinant mtlA protein?

Expression and purification of functional recombinant mtlA requires careful optimization:

  • Expression vectors: Select vectors with appropriate tags (commonly His-tags) to facilitate purification while minimizing interference with protein function .

  • Expression hosts: E. coli is commonly used for recombinant mtlA expression, though yeast systems may be preferable for certain applications, particularly when post-translational modifications are important .

  • Purification protocol:

    • Use affinity chromatography for initial purification (Ni-NTA for His-tagged proteins)

    • Consider adding a second purification step (ion exchange or size exclusion chromatography)

    • Buffer optimization is critical for maintaining stability and function

  • Quality control: Verify protein integrity using SDS-PAGE, Western blotting, and activity assays before experimental use.

  • Storage considerations: Store in Tris-based buffer with 50% glycerol at -20°C for stability . Aliquot samples to avoid repeated freeze-thaw cycles.

What techniques are used to study the membrane topology and structure-function relationships of mtlA?

Advanced structural and functional studies of mtlA employ several sophisticated techniques:

  • Membrane topology mapping:

    • Site-directed mutagenesis of key residues followed by functional assays

    • Cysteine-scanning mutagenesis combined with accessibility studies

    • Epitope insertion and antibody accessibility assays

  • Structural analysis:

    • X-ray crystallography of soluble domains

    • Cryo-electron microscopy for intact membrane-embedded protein

    • Molecular dynamics simulations to predict conformational changes

  • Functional analysis:

    • Radioactive substrate transport assays

    • Electrophysiological measurements in reconstituted systems

    • Fluorescence-based binding and transport assays

    • Isothermal titration calorimetry for binding kinetics

How can researchers address solubility issues when working with recombinant mtlA?

The membrane-associated nature of mtlA presents significant solubility challenges:

  • Fusion partners: Consider using solubility-enhancing fusion partners such as MBP, SUMO, or Thioredoxin.

  • Detergent screening: Systematically test different detergents:

Detergent ClassExamplesBest For
Non-ionicDDM, Triton X-100Initial solubilization
ZwitterionicCHAPS, Fos-CholineMaintaining function
Steroid-basedDigitonin, CholatePreserving oligomeric states
  • Expression conditions: Optimize by reducing temperature (16-20°C), using lower inducer concentrations, or employing specialized E. coli strains (C41/C43).

  • Co-expression strategies: Co-express with chaperones or partner proteins that stabilize mtlA.

  • Truncation constructs: Express functional domains separately if the full-length protein proves recalcitrant to solubilization.

What are the common pitfalls in experimental designs for studying mtlA function and how can they be avoided?

Researchers should be aware of these methodological pitfalls:

How does the domain organization of mtlA compare across different bacterial species?

The domain organization of mtlA exhibits significant variability across bacterial species:

  • Domain fusion patterns:

    • In many bacteria (e.g., E. coli), all domains (EIIA, EIIB, EIIC) are fused into a single polypeptide

    • In S. mutans, the EIICB domains (in mtlA) are separated from the EIIA domain (in mtlF)

    • Some species have completely separated all three domains into individual proteins

  • Sequence conservation:

    • The EIIC domain (membrane-spanning region) shows highest conservation

    • The EIIB domain shows moderate conservation

    • The EIIA domain (when present in mtlA) shows lowest conservation

  • Functional implications:

    • Separated domains may allow for differential regulation of expression

    • Physical separation may impact the efficiency of phosphate transfer between domains

    • Some species may have evolved alternative regulatory mechanisms based on their domain organization

What is known about the relationship between mtlA structure and substrate specificity?

The structural determinants of substrate specificity in mtlA involve several key elements:

  • Membrane-spanning regions: The transmembrane helices of the EIIC domain form the substrate translocation channel, with specific residues lining the channel determining substrate recognition.

  • Key residues for mannitol specificity:

    • Conserved polar residues in transmembrane segments form hydrogen bonds with mannitol hydroxyl groups

    • Aromatic residues provide hydrophobic interactions with the carbon backbone

    • Charged residues at the cytoplasmic and periplasmic faces guide substrate entry and exit

  • Phosphorylation sites: The conserved residues in the EIIB domain that become phosphorylated are critical for coupling transport to phosphorylation.

  • Conformational changes: Substrate binding induces conformational changes that are essential for translocation and are specific to the recognized sugar.

How is mtlA being used in synthetic biology and metabolic engineering applications?

Recent research has explored several innovative applications of mtlA in synthetic biology:

  • Biosensor development: mtlA-based biosensors for detecting mannitol and related compounds are being developed for both research and diagnostic applications.

  • Metabolic pathway engineering: Modification of mtlA specificity through protein engineering enables the transport of non-native substrates, expanding the range of carbon sources usable by engineered bacteria.

  • Vaccine development: Recombinant mtlA has potential as a component in subunit vaccines against pathogenic bacteria like Streptococcus mutans, targeting their sugar transport systems.

  • Drug delivery systems: Engineered bacterial cells with modified mtlA can be used for targeted delivery of therapeutic compounds that leverage the PTS system.

What experimental approaches are being used to study the dynamics of mtlA-mediated transport?

Cutting-edge techniques for studying mtlA transport dynamics include:

  • Single-molecule FRET: Allows real-time observation of conformational changes during substrate binding and transport.

  • Nanodiscs and proteoliposomes: Reconstitution of purified mtlA into artificial membrane systems enables controlled study of transport under defined conditions.

  • Time-resolved crystallography: Captures structural intermediates during the transport cycle when combined with substrate analogs and mutations that slow the process.

  • Computational approaches: Molecular dynamics simulations and quantum mechanical calculations predict energy barriers and transition states during transport.

  • In vivo tracking: Fluorescently labeled substrates combined with high-resolution microscopy enable real-time tracking of transport in living cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.