Recombinant Puma yagouaroundi Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Puma yagouaroundi Melanocyte-stimulating Hormone Receptor (MC1R)

The Recombinant Puma yagouaroundi Melanocyte-stimulating hormone receptor (MC1R) is a protein derived from the jaguarundi, a species of wild cat native to Central and South America. This receptor plays a crucial role in regulating melanin production and skin pigmentation. MC1R is a G protein-coupled receptor that responds to melanocyte-stimulating hormones (MSH), influencing the production of eumelanin, the pigment responsible for dark skin and hair color.

Structure and Function of MC1R

MC1R is composed of 317 amino acids and is characterized by its ability to bind to melanocyte-stimulating hormones, such as α-MSH. This binding activates adenylate cyclase, leading to an increase in cyclic AMP (cAMP) levels, which in turn stimulates the expression of microphthalmia transcription factor (MITF) and the production of eumelanin .

FeatureDescription
SpeciesPuma yagouaroundi (Jaguarundi)
Protein TypeRecombinant Protein
Tag InfoDetermined during production
Storage BufferTris-based buffer, 50% glycerol
Storage ConditionsStore at -20°C or -80°C

Research Findings and Applications

Research on MC1R has primarily focused on its role in melanin production and its implications for skin pigmentation disorders. In humans, mutations in the MC1R gene are associated with red hair and increased susceptibility to melanoma due to reduced protection against UV radiation . In the jaguarundi, MC1R mutations are linked to melanistic phenotypes, where animals exhibit darker coat colors .

Therapeutic Applications

MC1R-targeted drugs have potential therapeutic applications beyond skin pigmentation disorders. They can be used to treat inflammatory diseases due to the anti-inflammatory effects of MC1R activation . For instance, afamelanotide, a synthetic peptide that activates MC1R, is used to treat erythropoietic protoporphyria by increasing eumelanin production and providing protection against UV light .

Cancer Research

Studies have shown that MC1R mutations in red-haired individuals can lead to increased cancer risk by disrupting the protective mechanism involving the tumor suppressor gene PTEN. This disruption enhances the PI3K/Akt signaling pathway, promoting cell proliferation and cancer development .

Future Directions

Future studies should focus on the molecular mechanisms underlying MC1R's role in cancer and inflammation. Additionally, exploring the potential of MC1R-targeted drugs for treating a broader range of diseases could lead to significant advancements in pharmacology and dermatology.

References ELISA Recombinant Puma yagouaroundi Melanocyte-stimulating hormone receptor(MC1R). BUSM Researchers Find MC1R is a Potent Regulator of PTEN. Melanocortin 1 Receptor (MC1R): Pharmacological and Therapeutic Applications. Molecular Genetics and Evolution of Melanism in the Cat Family. Natural Selection of Melanism in Costa Rican Jaguar and Oncilla. Defining MC1R Regulation in Human Melanocytes by Its Agonist α-MSH. Draft de novo Genome Assembly of the Elusive Jaguarundi, Puma yagouaroundi.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Puma yagouaroundi (Jaguarundi) (Herpailurus yagouaroundi)
Target Names
Target Protein Sequence
MSVQGPQRRLLGSVNSTSPAAPRLGLAANQTGPRCLEVSVPDGLFLSLGLVSVVENVLVV AAIAKNRNLHSPMYYFICCLAVSDLLVSVSSVLETAVMLLLEAGTLAGRAAVVQQLDDII DVLVCGAMVSSLCFLGAIAVDRYISIFYALRYHSIVTLPRAWRAISAIWVASVLSSTLFI AYYDHTAVLLCLVSFFVAMLVLMAVLYVHMLARACQHARGIARLHKRQRPVHQGLGLKGA ATLTILLGIFFLCWGPFFLHLSLMVLCPRHPICGCVFKNFNLFLTLIICNSIVDPLIYAF RSQELRKTLREVLLCSW
Uniprot No.

Target Background

Function

The melanocyte-stimulating hormone receptor 1 (MC1R) is a G protein-coupled receptor for α-, β-, and γ-MSH and ACTH. Its activation stimulates adenylate cyclase, mediating melanogenesis – the production of eumelanin (black/brown) and pheomelanin (red/yellow) pigments – through cAMP signaling regulation in melanocytes.

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Structural Characterization of Jaguarundi MC1R

What structural features define the jaguarundi MC1R, and how can researchers characterize them?

The jaguarundi MC1R is a Class A (Rhodopsin-like) GPCR consisting of 317 amino acids organized into the canonical seven-transmembrane (7TM) domain structure characteristic of this receptor family . The receptor contains several structural elements including an N-terminal extracellular domain, seven transmembrane helices (TM1-TM7), three extracellular loops (ECL1-3), three intracellular loops (ICL1-3), and a C-terminal domain . Researchers can characterize these structural features through multiple complementary approaches. Hydropathy analysis can be employed to identify the transmembrane regions, while homology modeling based on crystal structures of related GPCRs can provide insights into the three-dimensional organization of the receptor. Circular dichroism (CD) spectroscopy of purified recombinant protein can confirm the predominant alpha-helical content expected in the transmembrane domains. For more detailed structural information, researchers might consider X-ray crystallography or cryo-electron microscopy of the purified receptor, though these techniques present significant challenges for membrane proteins.

The amino acid sequence of jaguarundi MC1R reveals several functionally important motifs and residues that are likely involved in ligand binding and signal transduction . The DRY motif (Asp-Arg-Tyr) at positions 142-144 is crucial for G-protein coupling, while residues in TM3, TM5, and TM6 likely form the ligand-binding pocket based on homology with other melanocortin receptors. Researchers can conduct site-directed mutagenesis studies targeting these conserved regions to assess their functional significance in the jaguarundi MC1R specifically. Additionally, epitope mapping using recombinant protein fragments can help identify regions important for antibody recognition, which is valuable for developing detection tools for this receptor.

Expression Systems for Recombinant Jaguarundi MC1R

What expression systems are optimal for producing functional recombinant jaguarundi MC1R protein?

The expression of functional recombinant jaguarundi MC1R requires careful consideration of the expression system to ensure proper protein folding, post-translational modifications, and membrane integration. Mammalian expression systems, particularly HEK293 or CHO cells, are often preferred for GPCR expression due to their ability to perform appropriate post-translational modifications and provide a native-like membrane environment . For establishing stable cell lines, researchers should consider using lentiviral or retroviral vectors carrying the jaguarundi MC1R gene with an appropriate epitope tag (e.g., FLAG, HA, or His) to facilitate detection and purification. The expression construct should ideally include a strong promoter (e.g., CMV) and appropriate Kozak sequence to enhance translation efficiency. Selection markers such as antibiotic resistance genes (puromycin, G418) allow for the isolation of stable transfectants.

Comparative Analysis of Jaguarundi MC1R with Other Felid MC1Rs

How does jaguarundi MC1R compare with MC1R from other felid species, and what methods can be used for comparative analysis?

Comparative analysis of jaguarundi MC1R with orthologs from other felid species provides valuable insights into evolutionary conservation, functional divergence, and species-specific adaptations. The Puma lineage, including jaguarundi (Puma yagouaroundi), mountain lion (Puma concolor), and the more distantly related cheetah (Acinonyx jubatus), diverged approximately 4.9 million years ago, making them excellent subjects for comparative studies . Researchers can employ multiple sequence alignment tools (e.g., MUSCLE, Clustal Omega) to analyze conservation patterns across felid MC1Rs, identifying conserved domains that likely play essential functional roles versus variable regions that may contribute to species-specific responses. Phylogenetic analysis using maximum likelihood or Bayesian methods can further elucidate the evolutionary relationships between these receptors and highlight potential instances of positive selection or convergent evolution.

Functional comparison requires expression of MC1Rs from different felid species in a standardized cellular background to control for host cell factors. Researchers can utilize receptor activation assays measuring cAMP accumulation, calcium mobilization, or β-arrestin recruitment to compare ligand potency and efficacy across species. Chimeric receptor approaches, where domains from different species' MC1Rs are swapped, can identify regions responsible for functional differences. Additionally, molecular dynamics simulations of homology models can predict structural differences in ligand binding pockets or G-protein coupling interfaces. Recent completion of the jaguarundi genome assembly (with scaffold N50 = 49.27 Mbp) facilitates genomic context comparison with other felids, potentially revealing differences in regulatory regions affecting expression patterns . These comparative approaches provide crucial context for understanding MC1R evolution within the Felidae family.

Functional Assays for Recombinant Jaguarundi MC1R

What are the optimal methods for assessing the functionality of recombinant jaguarundi MC1R in experimental settings?

Assessing the functionality of recombinant jaguarundi MC1R requires multiple complementary approaches targeting different aspects of receptor biology. Ligand binding assays using radiolabeled or fluorescently labeled melanocortin peptides (α-MSH, ACTH) can determine binding affinity (Kd) and receptor density (Bmax) in membrane preparations expressing the receptor. Saturation binding experiments with increasing concentrations of labeled ligand identify maximum binding capacity, while competition binding assays with unlabeled ligands determine relative binding affinities. Researchers should control for non-specific binding using excess unlabeled ligand or non-transfected cells. For signal transduction assessment, cAMP accumulation assays are particularly relevant as MC1R couples primarily to Gαs proteins, stimulating adenylyl cyclase activity. Time-course experiments can reveal activation kinetics, while dose-response curves determine EC50 values for different ligands.

For more detailed functional characterization, real-time measurement techniques provide valuable insights into receptor dynamics. Bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) assays can monitor protein-protein interactions between the receptor and downstream effectors in living cells. These approaches require fusion of appropriate donor and acceptor tags to the receptor and interaction partners. Receptor internalization and trafficking can be assessed through confocal microscopy of fluorescently tagged MC1R or by biotinylation assays measuring surface receptor density following ligand exposure. Additionally, researchers should consider evaluating β-arrestin recruitment using enzyme complementation assays or BRET approaches, as this pathway contributes to receptor desensitization and may initiate G-protein-independent signaling. Careful experimental design should include appropriate positive controls (e.g., human MC1R) and negative controls (untransfected cells or cells expressing unrelated GPCRs) to validate assay specificity.

Site-Directed Mutagenesis Approaches for Structure-Function Analysis

How can site-directed mutagenesis be applied to study structure-function relationships in jaguarundi MC1R?

Site-directed mutagenesis represents a powerful approach for elucidating the structural determinants of jaguarundi MC1R function through systematic modification of specific amino acid residues. Based on sequence analysis and homology with well-characterized melanocortin receptors, researchers can identify candidate residues likely involved in ligand binding, G-protein coupling, or receptor regulation . Mutations should be designed to test specific hypotheses about residue function, such as conservative substitutions to test the importance of charge (e.g., D→E, K→R) versus non-conservative changes to more dramatically alter properties (e.g., D→A, W→A). Alanine-scanning mutagenesis, where individual residues are systematically replaced with alanine throughout a domain of interest, can identify critical functional residues. PCR-based mutagenesis methods using complementary primers containing the desired mutation offer an efficient approach, with subsequent verification by sequencing to confirm the presence of only the intended changes.

Following mutagenesis, comprehensive functional assessment requires comparing wild-type and mutant receptors across multiple parameters. Researchers should quantify expression levels through Western blotting, flow cytometry, or ELISA to ensure comparable surface expression before interpreting functional differences . Binding assays with natural ligands and synthetic analogs can reveal changes in affinity or specificity, while signaling assays measuring multiple pathways (cAMP, Ca²⁺, ERK phosphorylation) can identify pathway-specific effects. Mutations affecting residues in transmembrane domains 3, 6, and 7 often impact ligand binding, while alterations to the DRY motif or intracellular loops typically affect G-protein coupling . For receptors showing altered function, molecular modeling can help interpret results by predicting structural consequences of mutations. Systematic analysis of multiple mutations provides a comprehensive map of functionally important regions in the jaguarundi MC1R and can reveal species-specific features when compared to mutational studies of MC1R from other species.

Computational Approaches for Studying Jaguarundi MC1R

What computational methods can effectively predict ligand interactions and functional properties of jaguarundi MC1R?

Computational approaches offer powerful tools for predicting and analyzing jaguarundi MC1R structure, dynamics, and interactions without the limitations of experimental systems. Homology modeling represents the foundation of computational studies, using crystal structures of related GPCRs as templates to predict the three-dimensional structure of jaguarundi MC1R . Model quality depends critically on template selection, with higher sequence identity templates (particularly in transmembrane regions) yielding more reliable models. Models should undergo rigorous validation using tools like PROCHECK or MolProbity to assess stereochemical quality, followed by energy minimization to resolve unfavorable atomic contacts. Refined models can then serve as the basis for molecular docking studies to predict ligand binding modes and affinities. Docking algorithms such as AutoDock, GOLD, or Glide can screen potential ligands in silico, predicting binding poses and interaction energies with the receptor binding pocket.

Molecular dynamics (MD) simulations extend beyond static structural predictions to capture the dynamic behavior of jaguarundi MC1R in a membrane environment. All-atom MD simulations in explicit lipid bilayers and solvent can reveal conformational changes associated with activation, identify water-mediated hydrogen bond networks, and characterize allosteric communication pathways within the receptor. For computationally intensive questions, coarse-grained approaches like Martini force field can simulate longer timescales while sacrificing atomic detail. Additionally, machine learning approaches are increasingly valuable, particularly for predicting functional effects of mutations or identifying novel ligands. Sequence-based methods using multiple sequence alignments of MC1R across species can identify co-evolving residues that likely form functional interaction networks. These computational predictions should guide experimental design rather than replace experimental validation, forming an iterative process where computational predictions inform experiments, and experimental results refine computational models.

Investigating MC1R Polymorphisms in Jaguarundi Populations

What methodologies are most effective for studying natural MC1R variations across jaguarundi populations?

Investigating MC1R polymorphisms across jaguarundi populations requires an integrated approach combining genomic analysis, functional characterization, and ecological context. The recently assembled jaguarundi genome provides an excellent reference for identifying MC1R variants . Researchers should design PCR primers targeting the MC1R coding region (957 bp) and flanking sequences based on the reference genome. DNA samples from geographically diverse jaguarundi populations can be obtained from blood, tissue, or non-invasive sources like fecal samples or shed hair, though the latter may require optimized extraction methods for degraded DNA. For population-level screening, techniques such as high-resolution melting analysis provide cost-effective initial variant detection, followed by Sanger sequencing of samples showing aberrant melting profiles. For larger sample sets, targeted next-generation sequencing approaches allow simultaneous analysis of multiple individuals with high coverage of the MC1R locus.

Identified variants should be functionally characterized to determine their phenotypic consequences. Recombinant expression of variant MC1R alleles in cell culture systems allows comparative assessment of receptor properties including subcellular localization, ligand binding affinity, and signaling efficiency . Population genetic analyses can reveal evolutionary forces acting on the MC1R locus, with metrics such as FST identifying population differentiation, while tests for selection (Tajima's D, dN/dS ratio) can detect signatures of positive or balancing selection. Geographic information systems (GIS) approaches correlating MC1R variants with environmental variables (temperature, precipitation, habitat type) may reveal adaptive patterns related to camouflage or thermoregulation. Researchers should also consider the broader genomic context, as nearby regulatory elements can influence MC1R expression patterns. This comprehensive approach connects genetic variation to functional consequences and ecological significance, providing insights into the role of MC1R in jaguarundi adaptation across diverse habitats.

Antibody Development and Validation for Jaguarundi MC1R Research

What strategies ensure specificity and sensitivity when developing antibodies against jaguarundi MC1R?

Developing specific antibodies against jaguarundi MC1R requires careful antigen design and rigorous validation to ensure both specificity and sensitivity. Researchers should analyze the MC1R sequence to identify regions with high antigenicity and low sequence conservation compared to other melanocortin receptors, reducing cross-reactivity . The N-terminal extracellular domain (amino acids 1-44) and C-terminal domain (amino acids 308-317) typically represent good candidate regions for antibody development, as they show greater sequence divergence between receptors while being accessible in intact cells. Synthetic peptides corresponding to these regions, conjugated to carrier proteins like KLH or BSA, can serve as immunogens. Alternatively, recombinant protein fragments expressing extracellular domains can be purified and used for immunization. For monoclonal antibody development, hybridoma technology using mice or rats immunized with these antigens provides the most specific reagents, while polyclonal antibodies from rabbits or goats offer higher sensitivity but potentially lower specificity.

Validation of antibodies must employ multiple complementary approaches to confirm specificity. Western blotting should demonstrate a band of appropriate molecular weight (approximately 34-37 kDa) in cells expressing jaguarundi MC1R but not in untransfected controls . Immunoprecipitation followed by mass spectrometry can verify that the antibody captures the intended protein. Immunocytochemistry should show appropriate membrane localization in transfected cells, while pre-absorption with immunizing peptide should eliminate specific staining. Cross-reactivity testing against other melanocortin receptors (especially MC3R, MC4R, and MC5R) and against MC1R from closely related species should be performed to establish specificity boundaries. Knockout or knockdown validation, where the antibody shows reduced or absent signal following MC1R depletion, provides the gold standard for specificity. Well-validated antibodies enable techniques such as immunohistochemistry, flow cytometry, and immunoprecipitation, greatly expanding the methodological toolkit available for jaguarundi MC1R research.

Addressing Challenges in Purification of Functional Recombinant MC1R

What techniques overcome common obstacles in purifying functional jaguarundi MC1R for structural and biochemical studies?

Purification of functional GPCRs like jaguarundi MC1R presents significant challenges due to their hydrophobicity, conformational flexibility, and dependence on the lipid environment. Successful purification requires careful optimization at each step, beginning with high-level expression in an appropriate system. For jaguarundi MC1R, baculovirus-infected insect cells or mammalian cells with inducible expression systems typically yield sufficient quantities for purification attempts . Addition of an N-terminal signal sequence and C-terminal affinity tag (such as His10, FLAG, or Twin-Strep) facilitates both expression and subsequent purification. During expression, culture conditions should be optimized, with temperature reduction (to 30°C for mammalian cells or 27°C for insect cells) often improving folding efficiency. Addition of antagonists or stabilizing ligands during expression can increase receptor stability by locking it in a specific conformation.

Membrane preparation and solubilization represent critical steps in GPCR purification. After cell harvest and disruption, membranes should be isolated by ultracentrifugation and washed thoroughly to remove peripheral proteins. Detergent selection profoundly impacts purification success, with mild detergents like DDM, LMNG, or GDN generally preferred for MC1R solubilization. Detergent screening using analytical-scale extractions followed by Western blotting can identify optimal conditions. Addition of cholesterol hemisuccinate (CHS) often enhances GPCR stability in detergent solutions. For affinity purification, immobilized metal affinity chromatography (IMAC) works well for His-tagged receptors, while anti-FLAG or Strep-Tactin matrices are effective for alternatively tagged constructs. Size exclusion chromatography as a final purification step separates monomeric receptor from aggregates and contaminants. Throughout purification, functional integrity should be monitored using ligand binding assays adapted to detergent solutions. For challenging cases, alternative approaches like reconstitution into nanodiscs, lipid cubic phase, or the use of fusion partners (T4 lysozyme, BRIL) that enhance stability may prove necessary to obtain functional purified receptor suitable for structural or biochemical studies.

Statistical Approaches for MC1R Signaling Studies

What statistical methods are most appropriate for analyzing complex datasets from jaguarundi MC1R signaling experiments?

Analysis of jaguarundi MC1R signaling data requires appropriate statistical methods to account for the complexity and variability inherent in GPCR signaling experiments. For dose-response studies measuring parameters like cAMP accumulation, calcium flux, or ERK phosphorylation, nonlinear regression analysis using four-parameter logistic models typically provides the best fit, yielding EC50 values, maximum responses (Emax), and Hill coefficients. Researchers should report 95% confidence intervals for these parameters rather than just point estimates to convey the precision of measurements. When comparing multiple conditions (e.g., wild-type versus mutant receptors, or responses to different ligands), statistical significance of differences in potency (EC50) should be assessed using extra sum-of-squares F-tests rather than comparing confidence intervals, as the latter approach is often too conservative. For experiments with multiple variables, two-way ANOVA followed by appropriate post-hoc tests (Tukey, Sidak, or Bonferroni) can identify significant main effects and interactions.

Time-course experiments examining receptor activation, desensitization, or internalization present particular analytical challenges. Area under the curve (AUC) analysis can quantify cumulative responses, while curve fitting to appropriate kinetic models (one- or two-phase exponential) extracts rate constants. For more complex signaling datasets with multiple readouts, multivariate approaches like principal component analysis (PCA) or partial least squares discrimination analysis (PLS-DA) can identify patterns and relationships not evident in univariate analyses. These methods can be particularly valuable for biased signaling studies examining multiple pathways simultaneously. Sample size determination should be guided by power analysis based on expected effect sizes and variability, with most GPCR signaling experiments requiring at least three independent biological replicates, each with technical triplicates. Proper normalization (to control conditions or reference compounds) is essential to control for day-to-day variability. Transparent reporting of all statistical methods, including software packages, tests performed, and exact p-values, ensures reproducibility and proper interpretation of experimental findings.

Interpreting Evolutionary Data on Jaguarundi MC1R

How should researchers interpret comparative genomic data to understand the evolutionary significance of jaguarundi MC1R?

Interpreting evolutionary data on jaguarundi MC1R requires integration of sequence analysis, structural biology, and functional studies within a phylogenetic framework. The jaguarundi belongs to the Puma lineage within Felidae, which diverged from other felid lineages approximately 4.9 million years ago . Comparative sequence analysis of MC1R genes across felids should begin with multiple sequence alignment followed by calculation of sequence identity and similarity matrices. Different evolutionary rates in various protein domains can be identified using sliding window analysis of nucleotide diversity (π) or substitution rates (dN/dS). Researchers should pay particular attention to transmembrane domains, which typically show higher conservation due to structural constraints, versus extracellular loops, which may exhibit greater variability reflecting adaptation to different ligands or environmental conditions .

Phylogenetic analysis using maximum likelihood or Bayesian approaches can reconstruct the evolutionary history of MC1R within felids, potentially revealing episodes of selection. Statistical tests for selection, such as McDonald-Kreitman tests comparing polymorphism and divergence, or likelihood ratio tests comparing models with different dN/dS parameters across branches, can identify episodes of positive or purifying selection. For hypothesis testing regarding specific amino acid changes, ancestral sequence reconstruction should be performed to infer the MC1R sequence at each node in the felid phylogeny. Functional assays comparing ancestral and extant MC1R variants can then determine whether sequence changes altered receptor properties. Researchers should consider the ecological and phenotypic context when interpreting evolutionary patterns, as MC1R variation often correlates with coat color adaptation to different environments. Integration of genomic context from the jaguarundi genome assembly can reveal whether selection has acted on regulatory regions affecting MC1R expression patterns in addition to coding sequence changes . These multifaceted analyses provide insights into how natural selection has shaped jaguarundi MC1R through felid evolution.

Implications of Jaguarundi MC1R Research for Understanding Felid Pigmentation

How can jaguarundi MC1R studies contribute to broader understanding of felid coat color genetics and evolution?

Research on jaguarundi MC1R offers valuable insights into the molecular basis of felid pigmentation patterns, which represent key adaptations to diverse ecological niches. Unlike many felids with spotted or striped patterns, the jaguarundi exhibits a relatively uniform coloration with two main color morphs: reddish-brown and gray-black. This distinctive pigmentation pattern makes jaguarundi an interesting comparative model for understanding the genetic basis of solid versus patterned coat colors in felids. By characterizing the functional properties of jaguarundi MC1R and comparing them with MC1Rs from other felid species with different coat patterns (such as the spotted ocelot or striped tiger), researchers can identify receptor variations that correlate with different pigmentation phenotypes. These comparisons should include binding affinity for melanocortin peptides, constitutive activity levels, and coupling efficiency to downstream signaling pathways, as differences in these parameters can influence the balance between eumelanin (black/brown) and pheomelanin (red/yellow) production in melanocytes.

The jaguarundi's ability to express different color morphs within the same species makes it particularly valuable for investigating the genetic architecture of color polymorphism in felids. Researchers should sequence the MC1R gene from individuals representing different color morphs to identify any coding variants associated with color differences. Beyond sequence variation, epigenetic regulation and interactions with other coat color genes (ASIP, TYRP1, PMEL) likely contribute to the jaguarundi's pigmentation patterns. Developmental studies examining the temporal and spatial expression of MC1R during hair follicle development could reveal how uniform coloration is established instead of spotted patterns. From an evolutionary perspective, comparative genomic approaches can reconstruct the ancestral pigmentation patterns in the Puma lineage and identify convergent evolution of coloration strategies across felid lineages . These studies provide a molecular foundation for understanding the adaptive significance of different pigmentation patterns in relation to habitat, predator avoidance, and thermoregulation across the Felidae family.

Emerging Technologies for Jaguarundi MC1R Research

What cutting-edge methodologies could advance the study of jaguarundi MC1R structure, function, and evolution?

Emerging technologies across multiple disciplines offer exciting opportunities to advance jaguarundi MC1R research beyond current methodological limitations. In structural biology, cryo-electron microscopy (cryo-EM) now enables determination of membrane protein structures without crystallization, potentially revealing the three-dimensional structure of jaguarundi MC1R in different conformational states. Single-particle cryo-EM of purified receptor in nanodiscs or amphipols could capture the receptor in ligand-free, agonist-bound, or antagonist-bound states, providing unprecedented insights into activation mechanisms. Complementary approaches like hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map conformational changes and solvent accessibility in response to different ligands or mutations, even with partially purified receptor preparations. For functional studies, genetically encoded biosensors based on FRET or bioluminescence principles enable real-time monitoring of MC1R signaling in living cells with subcellular resolution. These approaches can reveal spatiotemporal aspects of signaling that are inaccessible to traditional endpoint assays.

Genomic technologies like CRISPR-Cas9 editing now make it feasible to generate isogenic cell lines with precise modifications to the MC1R gene, creating cellular models to study receptor variants identified in wild jaguarundi populations. For evolutionary studies, long-read sequencing technologies (PacBio, Oxford Nanopore) facilitate assembly of the complete MC1R locus including regulatory regions that may have evolved differently across felid species . Ancient DNA techniques could potentially recover MC1R sequences from historical or paleontological jaguarundi samples, providing a temporal dimension to evolutionary analyses. In computational biology, enhanced sampling methods in molecular dynamics simulations and machine learning approaches for predicting protein-protein interactions offer new insights into MC1R function. Integration of multiple omics data (genomics, transcriptomics, proteomics) can place MC1R in its broader molecular context, revealing interaction networks that modulate receptor function. These technological advances, applied thoughtfully to specific research questions, promise to deepen our understanding of jaguarundi MC1R and its role in felid biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.