Recombinant Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-12 (acl-12)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Putative 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Acl-12 (Acl-12)

Acl-12 is a recombinant, full-length enzyme derived from Caenorhabditis elegans (nematode worm), expressed in E. coli with an N-terminal His-tag. It belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT) family, which catalyzes the acylation of lysophosphatidic acid (LPA) to form phosphatidic acid (PA), a critical precursor for glycerophospholipid biosynthesis .

ParameterValue
SpeciesCaenorhabditis elegans
SourceE. coli
TagN-terminal His-tag
Protein LengthFull-length (1–391 amino acids)
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Gene IDQ11087 (UniProt)
SynonymsLPAAT, 1-AGPAT, Lysophosphatidic acid acyltransferase

2.1. Enzymatic Activity

Acl-12 functions as an acyltransferase, transferring acyl groups from fatty acyl-CoA to the sn-2 position of LPA, yielding PA. This reaction is essential for de novo phospholipid synthesis and lipid signaling .

Key Features:

  • Substrate Specificity: Prefers polyunsaturated fatty acyl-CoAs (e.g., eicosapentaenoyl-CoA) over saturated or monounsaturated donors .

  • Membrane Topology: Predicted to localize to the cytosolic side of the endoplasmic reticulum (ER) or mitochondrial membrane, with catalytic motifs exposed to the cytosol .

2.2. Sequence and Motifs

Acl-12 contains conserved acyltransferase motifs (I–IV), critical for acyl-CoA binding and catalysis. These motifs are structurally similar to human AGPAT isoforms (e.g., AGPAT1, AGPAT2) .

Amino Acid Sequence Highlights:

  • Motif I: Cytosolic, involved in acyl acceptor (LPA) binding .

  • Motif IV: Deep within the membrane, facilitating acyl-CoA interaction .

3.1. Purification and Activity Assays

Acl-12 was purified using detergent-based methods (e.g., 6-cyclohexyl-1-hexyl-β-d-maltoside) to maintain solubility and activity. Enzymatic assays with [14C]oleoyl-CoA and LPA demonstrated robust activity, with a preference for unsaturated fatty acids .

SubstrateActivity (Relative Units)Reference
Eicosapentaenoyl-CoA100% (highest)
Linoleoyl-CoA85%
Palmitoyl-CoA50%

3.2. Comparative Analysis with Homologs

Acl-12 shares functional similarities with bacterial PlsC (e.g., Shewanella livingstonensis) and mammalian AGPATs, though substrate preferences vary. For example, P. falciparum PfLPLAT1 (a parasitic homolog) exhibits dual LPAAT/LPCAT activity but prefers polyunsaturated acyl donors .

Key Distinctions:

FeatureAcl-12Human AGPAT2PfLPLAT1
Primary SubstrateLPALPALPA, LPC
Acyl-CoA PreferencePolyunsaturatedSaturated/monounsaturatedPolyunsaturated
LocalizationER/mitochondriaERER (parasite)

3.3. Role in Lipid Metabolism

Acl-12 contributes to phospholipid homeostasis and signaling. In C. elegans, its dysregulation may affect membrane fluidity, development, or stress responses .

4.1. Biotechnological and Biochemical Studies

  • Lipid Engineering: Used to produce polyunsaturated phospholipids in E. coli .

  • Drug Targeting: Potential candidate for modulating lipid metabolism in parasitic pathogens (e.g., Plasmodium) .

4.2. Challenges and Opportunities

  • Structural Insights: Cryo-EM or X-ray crystallography studies are needed to resolve membrane topology and substrate interactions .

  • Regulatory Mechanisms: AMP-activated protein kinase (AMPK) or PPARα pathways may modulate acl-12 activity, as observed in mammalian AGPATs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
acl-12; C01C10.3; Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-12; 1-AGP acyltransferase; 1-AGPAT; Lysophosphatidic acid acyltransferase; LPAAT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
acl-12
Target Protein Sequence
MLKSGLMDTDDQKVGVRVANIDMSERTDNVHLIEIRRIISLVGAAYFFFMTAWVVPVACV ITVSLLFPLMLFSTPLFNYLEHKLCAMVNAHWNAVSVFVGATVTEYGTNLAGYAEEKCLL LANHLGLLDHFVLMQSLNGKGSIRSRWMWVIYNIWKYTPLGVMWTSHGNFFVNGGVSKRD SVLSSFRDHLKNSFYKYDYGWVIMYPEGSRLYLVKNSGRTFAEKNGLKPLDNCVYPRTGA AHAVLDVLGPTDDSLSMSKCGKGEPIKYIIDATIGYRKGAVPDICDVMMGDWESVEASQF AVHYDVIPVKPEWSDENLLKEFLYERYIIKDKLLAEFYKTGHFPGDKTKVIPNNYEMMFA QVFWGCLYYAHYVYWLRPLIVHSWTSFLSIF
Uniprot No.

Target Background

Function

This recombinant Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-12 (acl-12) catalyzes the conversion of lysophosphatidic acid (LPA) to phosphatidic acid by acylating the sn-2 position of the glycerol backbone.

Database Links

KEGG: cel:CELE_C01C10.3

STRING: 6239.C01C10.3.1

UniGene: Cel.7660

Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What role do acyltransferases like acl-12 play in cellular lipid metabolism?

Acyltransferases such as acl-12 catalyze a fundamental step in glycerolipid biosynthesis by transferring fatty acyl groups from acyl-CoA donors to glycerol-3-phosphate (G3P) acceptor molecules. This reaction is critical for:

  • Formation of membrane phospholipids essential for cellular architecture

  • Synthesis of storage lipids like triglycerides

  • Production of signaling molecules derived from lysophosphatidic acid (LPA)

In eukaryotic systems, most G3P acyltransferases (GPATs) acylate the sn-1 position to produce 1-acyl-LPA, which serves as a precursor for the generation of phosphatidic acid and subsequent lipid species. The positional specificity of acylation (sn-1 versus sn-2) can significantly influence the downstream fate of the lipid intermediates and their biological functions .

What are the optimal conditions for expression and purification of recombinant acl-12?

The optimal expression and purification protocol for recombinant acl-12 involves:

Expression System:

  • Host: E. coli (commonly used for acl-12 expression)

  • Vector: Expression vector with N-terminal His-tag

  • Full-length construct: Amino acids 1-391 of acl-12 protein

Purification Method:

  • Cell lysis under appropriate buffer conditions

  • Affinity chromatography using Ni-NTA resin (leveraging the His-tag)

  • Elution with imidazole gradient

  • Buffer exchange to remove imidazole

  • Storage as lyophilized powder

Reconstitution Protocol:

  • Centrifuge vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (default 50%)

  • Aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

How can researchers accurately determine the regiospecificity of acyltransferases like acl-12?

Determining the regiospecificity of acyltransferases such as acl-12 requires specialized analytical techniques to distinguish between sn-1 and sn-2 acylation:

Borate-TLC Method:

  • Conduct enzymatic reaction with [14C]G3P as acyl acceptor and specific acyl-CoAs as donors

  • Spot reaction products directly onto borate-impregnated TLC plates

  • Develop plates with appropriate solvent systems

  • Borate-TLC allows resolution of MAG α and β isomers with minimal acyl migration

  • Compare migration patterns with chemically synthesized sn-1 and sn-2 MAG standards

GC-MS Confirmation:

  • Perform large-scale enzymatic assays

  • Recover bands corresponding to putative products from borate-TLC

  • Silylate samples to improve volatility

  • Analyze by GC-MS

  • Compare EI-MS spectra and retention times with synthetic standards

  • Include appropriate controls (empty vector, omission of substrate)

What analytical techniques are most effective for studying acl-12 substrate specificity?

Several complementary analytical techniques are essential for comprehensive characterization of acl-12 substrate specificity:

Radiometric Assays:

  • Utilize [14C]G3P as radioactive substrate with various acyl-CoA donors

  • Separate reaction products by thin-layer chromatography

  • Visualize and quantify radioactive products using phosphorimaging

  • Calculate enzyme activity based on product formation rate

Mass Spectrometry-Based Approaches:

  • Liquid chromatography-mass spectrometry (LC-MS) for non-radioactive analysis

  • Multiple reaction monitoring (MRM) for targeted quantification of specific products

  • High-resolution MS for detailed structural characterization

Kinetic Analysis:

  • Determine Km and Vmax values for different acyl-CoA substrates

  • Construct substrate saturation curves

  • Compare catalytic efficiency (kcat/Km) across substrate range

  • Analyze inhibition patterns with competitive substrates

How do conserved motifs in acl-12 compare to other acyltransferases, and what are their functional implications?

Comparative sequence analysis of acyltransferases has revealed several highly conserved motifs critical for catalytic function, including three motifs identified in mammalian AGPATs:

Conserved Motifs in AGPATs:

MotifConsensus SequenceProposed Function
IKX₂LX₆GX₁₂RAcyl-CoA binding
II[Unknown in search results]Likely G3P binding
III[Unknown in search results]Catalytic residues

These conserved motifs serve as potential targets for site-directed mutagenesis to elucidate structure-function relationships in acl-12. Mutations in these conserved regions typically result in significant reduction or loss of enzymatic activity, as demonstrated in related enzymes. For example, site-directed mutagenesis of putative active-site residues in plant GPAT6 nearly eliminated its phosphatase activity, altering the product profile from predominantly MAGs to 2-acyl-LPA .

What experimental approaches can distinguish between acyltransferase and phosphatase activities in bifunctional enzymes related to acl-12?

Some acyltransferases exhibit bifunctional activity, possessing both acyltransferase and phosphatase domains. To distinguish and characterize these activities:

Product Analysis Strategy:

  • Conduct enzymatic reactions with [14C]G3P and appropriate acyl-CoA substrates

  • Separate reaction products into phosphorylated (LPA) and dephosphorylated (MAG) fractions

  • Quantify the ratio of LPA to MAG to assess relative activities

  • Compare with enzymes known to possess only acyltransferase activity

Domain Mutagenesis Approach:

  • Identify putative phosphatase domain through sequence homology

  • Generate site-directed mutants of conserved residues

  • Assay mutants for selective loss of phosphatase activity while retaining acyltransferase function

  • Analyze product profiles (LPA vs. MAG ratio) as indicators of functional alterations

Inhibitor Studies:

  • Apply selective phosphatase inhibitors

  • Monitor differential effects on acyltransferase versus phosphatase activities

  • Establish inhibitor profiles characteristic of bifunctional enzymes

What is known about the evolutionary relationships between acl-12 and acyltransferases across different taxonomic groups?

Phylogenetic analysis of acyltransferases reveals interesting evolutionary patterns that provide context for understanding acl-12's function:

Evolutionary Distribution:

  • Classical membrane-bound eukaryotic GPATs preferentially acylate the sn-1 position

  • Plant-specific GPATs (GPAT4-6) exhibit distinctive sn-2 acylation preference

  • Bifunctional acyltransferase-phosphatase activity appears to be a specialized adaptation

Taxonomic Restrictions:

  • Close homologs of plant-specific GPATs with sn-2 preference exist in all land plants

  • These specialized GPATs are absent in animals (including C. elegans), fungi, and microorganisms

  • The emergence of these enzymes likely facilitated plant adaptation to terrestrial environments through synthesis of protective exterior polyesters (cutin and suberin)

The evolutionary placement of acl-12 within this framework suggests it likely belongs to the classical eukaryotic GPAT family with sn-1 positional preference, consistent with its annotation as a 1-acyl-sn-glycerol-3-phosphate acyltransferase .

What heterologous expression systems are most effective for functional studies of acl-12?

Multiple expression systems offer distinct advantages for functional characterization of acl-12:

E. coli Expression System:

  • Advantages: Rapid growth, high yield, simple purification

  • Limitations: Lacks eukaryotic post-translational modifications

  • Best for: Initial biochemical characterization, structural studies

  • Protocol modifications: Lower induction temperature (16-18°C) often improves solubility

Yeast Expression Systems:

  • Advantages: Eukaryotic processing, amenable to complementation studies

  • Specific application: Expression in GPAT-deficient mutants (e.g., gat1Δ) allows direct assessment of acl-12 function through rescue experiments

  • Analytical approach: Monitor lipid profile changes using mass spectrometry

Cell-Free Translation Systems:

  • Advantages: Rapid expression, avoids toxicity issues

  • Example: Wheat germ cell-free translation system has been successfully employed for acyltransferase expression

  • Applications: Ideal for rapid screening of mutants or substrate specificity studies

How can researchers accurately measure acl-12 enzyme kinetics and what parameters should be optimized?

Accurate enzyme kinetic measurements for acl-12 require careful optimization of multiple parameters:

Assay Optimization Variables:

  • pH (typically 7.0-8.0 for most acyltransferases)

  • Temperature (25-37°C range)

  • Divalent cation concentration (Mg²⁺, Mn²⁺)

  • Detergent type and concentration (critical for membrane-associated enzymes)

  • Substrate concentrations (both G3P and acyl-CoA)

Kinetic Parameter Determination:

  • Initial velocity measurements under varying substrate concentrations

  • Lineweaver-Burk, Eadie-Hofstee, or non-linear regression analysis

  • Determination of Km, Vmax, and kcat values

  • Product inhibition studies to elucidate reaction mechanism

Common Methodological Challenges:

  • Limited solubility of long-chain acyl-CoA substrates

  • Product solubility and detection limitations

  • Potential for acyl migration in MAG products

  • Mixed micelle formation affecting actual substrate concentration

How does the activity of acl-12 compare with mammalian AGPATs and what implications does this have for metabolic research?

Comparative analysis between acl-12 and mammalian AGPATs reveals important functional relationships:

Regulatory Differences:

  • Mammalian AGPATs show transcriptional regulation by PPARα, as evidenced by 25% lower cardiac mAGPAT activities in PPARα null mice

  • When treated with clofibrate (a PPARα activator), cardiac mAGPAT activities were 50% lower in PPARα null mice compared to wild-type animals

  • These activity changes corresponded with altered mRNA levels of specific AGPAT isoforms (enhanced mAGPAT3, reduced mAGPAT2)

Functional Implications:

  • Total AGPAT activity may be regulated both by the relative abundance of different isoforms and by the expression level of each isoform

  • Differential substrate preferences among isoforms likely influence lipid composition

  • Understanding the regulatory mechanisms of acl-12 in C. elegans could provide models for studying AGPAT regulation in higher organisms

What experimental approaches can elucidate the physiological roles of acl-12 in C. elegans?

Several complementary experimental approaches can help determine the physiological roles of acl-12 in C. elegans:

Genetic Manipulation Strategies:

  • CRISPR/Cas9-mediated gene knockout or knockdown

  • RNAi-mediated silencing

  • Transgenic overexpression

  • Generation of point mutations in conserved motifs

Phenotypic Analysis Methods:

  • Lipidomic profiling using LC-MS/MS to detect alterations in glycerophospholipid compositions

  • Membrane fluidity analysis using fluorescence anisotropy

  • Developmental timing assessments

  • Reproductive capacity and brood size measurements

  • Lifespan and stress resistance evaluations

Tissue-Specific Expression Analysis:

  • Creation of GFP-fusion constructs to visualize expression patterns

  • Tissue-specific promoters to drive targeted expression

  • Immunohistochemistry with specific antibodies

  • Single-cell RNA sequencing to determine expression in specific cell types

What challenges exist in translating findings from acl-12 research to applications in biotechnology or medicine?

Several significant challenges must be addressed when translating acl-12 research findings:

Translational Challenges:

  • Structural and functional differences between acl-12 and mammalian homologs

  • Species-specific regulation of enzyme activity and expression

  • Integration of acyltransferase function within complex lipid metabolic networks

  • Limited availability of specific inhibitors for targeted modulation

Potential Applications Despite Challenges:

  • Platform for screening acyltransferase modulators

  • Model system for studying membrane lipid homeostasis

  • Bioengineering applications for modified lipid production

  • Insights into evolutionary conservation of lipid metabolism

Methodological Approaches to Address Challenges:

  • Comprehensive structure-function analyses through protein engineering

  • Development of transgenic models expressing humanized variants

  • Systems biology approaches integrating transcriptomics, proteomics, and lipidomics

  • High-throughput screening methods for compound libraries

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.