Recombinant Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-2 (acl-2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Putative 1-Acyl-sn-Glycerol-3-Phosphate Acyltransferase Acl-2 (acl-2)

Recombinant Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-2 (acl-2) is a lab-produced enzyme derived from Caenorhabditis elegans, designed to study lipid biosynthesis pathways. It belongs to the AGPAT (1-acylglycerol-3-phosphate O-acyltransferase) family, which catalyzes the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA), a critical step in phospholipid and triacylglycerol (TAG) synthesis . The recombinant form is expressed in E. coli with an N-terminal His-tag for purification and structural studies .

Biochemical Properties and Function

3.1. Enzymatic Activity
acl-2 facilitates the acylation of LPA at the sn-2 position, producing PA, a precursor for phosphatidylcholine (PC), phosphatidylethanolamine (PE), and phosphatidylinositol (PI) . This reaction is substrate-specific:

  • Acyl Donors: Prefers saturated/mono-unsaturated fatty acyl-CoA (e.g., 16:0-CoA, 18:1-CoA) over polyunsaturated acyl-CoA (e.g., 20:4-CoA) .

  • Acylation Position: Primarily targets the sn-1 position of PI in C. elegans, regulating membrane lipid composition .

3.2. Role in Lipid Metabolism

  • Phospholipid Synthesis: PA generated by acl-2 is dephosphorylated by phosphatidate phosphatases (PAPs) to diacylglycerol (DAG), a substrate for TAG synthesis via DGATs .

  • Signaling Molecules: PA derivatives include PI, critical for insulin signaling and cellular membrane integrity .

Research Findings and Functional Insights

4.1. Genetic and Physiological Studies

  • Tissue-Specific Expression: In C. elegans, acl-2 is strongly expressed in seam cells, influencing epidermal development. Mutations in acl-2 disrupt seam cell divisions and alter phosphatidylinositol (PI) species (e.g., reduced 18:0/20:5-PI, increased 18:1/20:5-PI) .

  • Regulatory Mechanisms: In mice, cardiac AGPAT isoforms (e.g., mAGPAT3) are regulated by PPARα, a nuclear receptor controlling lipid metabolism . While direct PPARα regulation of C. elegans acl-2 is unconfirmed, conserved motifs suggest similar regulatory pathways.

4.2. Mutational Analysis

  • Enzymatic Defects: Mutations in conserved motifs (e.g., R149A in human AGPAT1) abolish activity, highlighting the importance of charged residues in acyl-CoA binding .

  • Phenotypic Effects: acl-8 acl-9 acl-10 triple mutants in C. elegans accumulate 18:1/20:5-PI, indicating compensatory acyltransferase activity from other isoforms .

Applications in Research and Industry

5.1. Enzymatic Assays
acl-2 is used to study sn-2-acyl lysoPI acyltransferase (LPIAT) activity. Assays involve:

  1. Substrates: LysoPI (e.g., bovine liver-derived) and acyl-CoA donors.

  2. Detection: TLC separation of radiolabeled products, followed by PLA₂ treatment to confirm positional specificity .

5.2. Diagnostic Tools
Recombinant acl-2 serves as an antigen in ELISA kits for detecting antibodies or quantifying protein levels in biological samples .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
acl-2; T06E8.1; Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-2; 1-AGP acyltransferase; 1-AGPAT; Lysophosphatidic acid acyltransferase; LPAAT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
acl-2
Target Protein Sequence
MENFWSIVVFFLLSILFILYNISTVCHYYMRISFYYFTILLHGMEVCVTMIPSWLNGKGA DYVFHSFFYWCKWTGVHTTVYGYEKTQVEGPAVVICNHQSSLDILSMASIWPKNCVVMMK RILAYVPFFNLGAYFSNTIFIDRYNRERAMASVDYCASEMKNRNLKLWVFPEGTRNREGG FIPFKKGAFNIAVRAQIPIIPVVFSDYRDFYSKPGRYFKNDGEVVIRVLDAIPTKGLTLD DVSELSDMCRDVMLAAYKEVTLEAQQRNATRRGETKDGKKSE
Uniprot No.

Target Background

Function
This recombinant putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-2 (acl-2) catalyzes the conversion of lysophosphatidic acid (LPA) to phosphatidic acid by acyl moiety incorporation at the sn-2 position of the glycerol backbone.
Database Links

KEGG: cel:CELE_T06E8.1

STRING: 6239.T06E8.1.2

UniGene: Cel.36470

Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What catalytic reaction does 1-acyl-sn-glycerol-3-phosphate acyltransferase perform?

This enzyme catalyzes the chemical reaction:

acyl-CoA + 1-acyl-sn-glycerol 3-phosphate → CoA + 1,2-diacyl-sn-glycerol 3-phosphate

The systematic name of this enzyme class is acyl-CoA:1-acyl-sn-glycerol-3-phosphate 2-O-acyltransferase. Other names in common use include 1-acyl-sn-glycero-3-phosphate acyltransferase, 1-acyl-sn-glycerol 3-phosphate acyltransferase, 1-acylglycero-3-phosphate acyltransferase, 1-acylglycerolphosphate acyltransferase, 1-acylglycerophosphate acyltransferase, and lysophosphatidic acid-acyltransferase .

This enzyme participates in three important metabolic pathways:

  • Glycerolipid metabolism

  • Glycerophospholipid metabolism

  • Ether lipid metabolism

What are the key conserved motifs in AGPAT family enzymes?

Based on comparative studies of murine AGPAT isoforms, researchers have identified three highly conserved motifs in these enzymes, including one novel motif/pattern KX₂LX₆GX₁₂R. These conserved regions are likely critical for the catalytic function and substrate recognition .

The identification of these motifs is important for:

  • Understanding structure-function relationships

  • Predicting active site residues

  • Designing site-directed mutagenesis experiments

  • Identifying other potential family members through bioinformatic analyses

What are the optimal conditions for expressing recombinant acl-2 in E. coli?

When expressing recombinant acl-2 in E. coli, researchers should consider the following parameters based on standard protocols and available product information:

Expression and Purification Protocol:

  • Expression host: E. coli (specific strain not specified in product information)

  • Fusion tag: N-terminal His tag (facilitates purification via nickel affinity chromatography)

  • Purity: >90% as determined by SDS-PAGE

  • Final form: Lyophilized powder

Storage and Reconstitution:

  • Storage buffer: Tris/PBS-based buffer containing 6% Trehalose, pH 8.0

  • Recommended reconstitution: Deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Long-term storage: Add 5-50% glycerol (final concentration) and store at -20°C/-80°C

  • Stability notes: Repeated freeze-thaw cycles should be avoided; working aliquots may be stored at 4°C for up to one week

What purification strategies are most effective for acl-2?

While specific purification strategies for acl-2 are not detailed in the search results, the following methodological approach is recommended based on the recombinant protein's characteristics:

  • Initial Capture:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resin to capture the His-tagged protein

    • Wash with increasing imidazole concentrations to remove weakly bound contaminants

    • Elute with high imidazole buffer

  • Secondary Purification:

    • Size exclusion chromatography to separate aggregates and further purify the protein

    • Ion exchange chromatography as needed for removal of remaining contaminants

  • Quality Control:

    • SDS-PAGE to confirm purity (target >90%)

    • Western blot to confirm identity

    • Activity assay to confirm functionality

What methods can be used to measure acl-2 enzyme activity?

Several approaches can be used to measure acl-2 activity, drawing on methodologies used for similar enzymes:

Direct Activity Measurement:
A direct homogeneous assay approach similar to that developed for ATP citrate lyase (ACL) could be adapted for acl-2. Such an assay might include:

  • Incubation of purified acl-2 with radiolabeled substrate (e.g., [¹⁴C]-labeled acyl-CoA)

  • Quenching the reaction with EDTA

  • Adding a specific detection agent to detect the radiolabeled product

  • Measuring signal with appropriate detection equipment

Traditional Coupled Assays:
Enzyme activity can also be measured indirectly by coupling to other enzyme reactions. For example, the CoA produced in the acl-2 reaction could be detected through a secondary reaction that produces a spectrophotometrically detectable product.

How can researchers design optimal experiments to characterize acl-2 function?

When designing experiments to characterize acl-2 function, researchers should consider factorial experimental designs to efficiently test multiple variables:

Complete Factorial Design Approach:
This approach allows testing of multiple independent variables simultaneously, providing information about both main effects and interaction effects. For acl-2 characterization, relevant factors might include:

  • Substrate concentrations (acyl-CoA and 1-acyl-sn-glycerol-3-phosphate)

  • pH

  • Temperature

  • Cofactor concentrations

  • Enzyme concentration

The advantage of factorial designs over testing one factor at a time is that they:

  • Reduce the total number of experiments needed

  • Allow detection of interaction effects between variables

  • Provide more statistical power for the same number of measurements

Example Experimental Setup:
When investigating pH and temperature effects on acl-2 activity, a factorial design would test all combinations of selected pH values and temperatures, rather than varying each independently.

pHTemperature (°C)Experimental Condition
6.5251
6.5372
7.5253
7.5374

This approach would reveal not just the main effects of pH and temperature but also any interaction between these factors .

How do different isoforms of 1-acyl-sn-glycerol-3-phosphate acyltransferase differ in expression and function?

Studies on murine AGPATs have revealed differential tissue expression profiles among isoforms:

  • mAGPAT1 and mAGPAT3 are ubiquitously expressed in most tissues

  • mAGPAT2, mAGPAT4, and mAGPAT5 are expressed in a tissue-specific manner

These expression patterns suggest specialized roles for different isoforms. For example, mAGPAT2 expressed in in vitro transcription and translation reactions and in transfected COS-1 cells exhibited specificity for 1-acyl-sn-glycerol 3-phosphate .

How is acl-2 expression regulated in different tissues and organisms?

Research on murine AGPAT isoforms provides insights into possible regulatory mechanisms:

PPARα-Mediated Regulation:

  • Cardiac mAGPAT activities were 25% lower in PPARα null mice compared with wild-type

  • Activities were 50% lower in PPARα null mice fed clofibrate compared with clofibrate-fed wild-type animals

  • This activity modulation was accompanied by significant changes in mRNA levels of mAGPAT3/mAGPAT2

  • mRNA expression of cardiac mAGPAT3 appears to be regulated by PPARα activation

These findings suggest that:

  • Nuclear receptors like PPARα may play a role in regulating AGPAT expression

  • Cardiac AGPAT activity may be regulated both by the composition of AGPAT isoforms and by the levels of each isoform

  • Nutritional or pharmacological interventions (e.g., clofibrate treatment) may modulate AGPAT activity

What are the challenges in crystallizing acl-2 for structural studies?

While specific challenges for acl-2 crystallization are not detailed in the search results, membrane-associated enzymes like acyltransferases often present several difficulties:

  • Membrane Association: The likely membrane association of acl-2 makes it challenging to isolate in a form suitable for crystallization.

  • Conformational Flexibility: Enzymes often adopt multiple conformations, particularly during catalysis, which can hinder crystal formation.

  • Stability Issues: The storage conditions for recombinant acl-2 (Tris/PBS-based buffer with 6% Trehalose) suggest potential stability challenges that might affect crystallization.

  • Expression and Purification: Achieving the high purity (>99%) typically required for crystallography can be challenging, especially for membrane-associated proteins.

Researchers have employed various strategies to overcome these challenges, including protein engineering approaches and the use of lipidic cubic phase crystallization methods specifically designed for membrane proteins .

What are promising research directions for acl-2 studies?

Future research on acl-2 could productively focus on several areas:

  • Structural Biology: Determining the three-dimensional structure through X-ray crystallography or cryo-EM would provide insights into catalytic mechanism and substrate specificity.

  • Metabolic Integration: Investigating how acl-2 functions within broader glycerolipid and phospholipid metabolic networks using systems biology approaches.

  • Isoform-Specific Functions: Comparative studies of different AGPAT isoforms to understand their specialized roles in different tissues and organisms.

  • Regulatory Mechanisms: Exploring transcriptional, post-transcriptional, and post-translational regulation of acl-2 expression and activity.

  • Development of Specific Inhibitors: Design of isoform-specific inhibitors as research tools and potential therapeutic agents.

These directions would benefit from the multi-factorial experimental designs described earlier to efficiently explore the complex parameter space involved in enzyme function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.