Recombinant Putative 2-aminoethylphosphonate transport system permease protein phnU (phnU)

Shipped with Ice Packs
In Stock

Description

Biological Function

phnU functions as a permease in ATP-binding cassette (ABC) transporters that mediate 2AEP uptake. Its role varies across bacterial species and environmental conditions:

  • In Salmonella typhimurium: phnU is part of the phn operon (phnCDEFGHIJKLMNOP), which includes a substrate-binding protein (PhnD), ATPase (PhnC), and permease (PhnE). This system facilitates 2AEP transport under phosphate-limiting conditions .

  • In Pseudomonas putida BIRD-1: phnU forms the AepSTU transporter alongside AepS (substrate-binding protein) and AepT (ATPase). AepSTU operates under nitrogen limitation but plays an auxiliary role compared to the primary transporter AepXVW .

Transport Mechanism and Regulation

  • Dual Regulatory Control:

    • In P. putida, 2AEP utilization is regulated by PhoBR (phosphate starvation) and NtrBC (nitrogen starvation). phnU expression is induced only when carbon, nitrogen, or phosphorus is depleted .

    • AepSTU (including phnU) is constitutively expressed but enhances 2AEP uptake under phosphorus limitation when AepXVW is inactive .

  • Knockout Studies:

    • Deletion of aepXVW (the primary transporter in P. putida) abolished 2AEP uptake under phosphorus limitation but not nitrogen limitation .

    • AepSTU (phnU-containing) mutants showed reduced 2AEP transport efficiency, confirming its auxiliary role .

Enzymatic Coupling

phnU-dependent transport is linked to the PhnWX catabolic pathway:

  1. PhnW: Transaminase converting 2AEP to phosphonoacetaldehyde (PAA) .

  2. PhnX: Phosphonatase hydrolyzing PAA to inorganic phosphate and acetaldehyde .

Applications and Significance

  • Biochemical Research: Recombinant phnU enables structural studies of ABC transporters and substrate specificity assays .

  • Environmental Adaptation: Insights into phnU’s regulation improve understanding of bacterial survival in nutrient-poor environments .

  • Biotechnology: Potential applications in metabolic engineering for phosphorus recycling or bioremediation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
phnU; STY0466; t2436; Putative 2-aminoethylphosphonate transport system permease protein PhnU
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Salmonella typhi
Target Names
phnU
Target Protein Sequence
MSLILPLEKPALNLRPLLWLLLPLLALATLFFWPLSLIVEQALRGANGEIGLETFRQVVD SKRFVGALLNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELIGRVVDTFIALPTFLIT LAFTFIYGSAGLLNGALMSLFAFELPPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQI DKSQLEAASILGAHPLRVIGQVIFPAALPALMASGSLCLLLTTNEFGIVLFIGAKGVNTL PMMVYSKAILESDYTVACMIALINIVLSLGLFSLYRLAASRTGVRSQPC
Uniprot No.

Target Background

Function

Putative component of the PhnSTUV complex (TC 3.A.1.11.5) involved in 2-aminoethylphosphonate transport. Likely responsible for substrate translocation across the membrane.

Database Links

KEGG: stt:t2436

STRING: 220341.STY0466

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of the phnU protein?

PhnU is a putative 2-aminoethylphosphonate transport system permease protein from Salmonella typhi, consisting of 289 amino acids. It functions as part of a membrane transport system specifically involved in the translocation of aminoethylphosphonate compounds across the bacterial membrane. As a permease protein, phnU likely forms part of the transmembrane channel component of this transport system . The amino acid sequence reveals multiple transmembrane domains characteristic of membrane transport proteins, with hydrophobic regions that anchor the protein within the lipid bilayer.

What expression systems are most effective for recombinant phnU production?

E. coli expression systems have been demonstrated to be effective for the recombinant production of phnU protein . When expressing membrane transport proteins like phnU, it is crucial to select appropriate E. coli strains such as C41(DE3) or MQ614, which are specifically engineered to handle membrane protein expression. These strains help mitigate the common challenges associated with membrane protein expression, including toxicity and inclusion body formation . The effectiveness of the expression system should be evaluated through functional assays rather than relying solely on protein quantity detected by immunoblotting or protein staining.

How can I confirm the functionality of recombinant phnU protein?

Confirming the functionality of recombinant phnU requires assessing its substrate binding and transport capabilities. A scintillation proximity-based radioligand-binding assay can be employed to determine transport protein function both in crude cell extracts and in purified form . This method is advantageous over traditional transport assays as it allows for direct measurement of substrate binding even in a detergent-solubilized state. For phnU specifically, using radiolabeled 2-aminoethylphosphonate as a substrate would be appropriate. Additionally, reconstituting the purified protein into proteoliposomes enables measurement of actual transport activity across a membrane, which provides definitive evidence of functionality .

What are the optimal conditions for solubilizing and purifying recombinant phnU?

For optimal solubilization and purification of recombinant phnU, a systematic approach is necessary. The protein can be effectively extracted from E. coli membranes using a mild detergent such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration. The His-tagged version of phnU can be purified using immobilized metal affinity chromatography (IMAC) .

Purification ParameterRecommended Condition
Solubilization Detergent1% DDM or 1% LMNG
Buffer Composition50 mM Tris-HCl pH 8.0, 150-300 mM NaCl, 10% glycerol
Imidazole Concentration20 mM (wash buffer), 250 mM (elution buffer)
Temperature4°C throughout the purification process
Stabilizing Additives1 mM DTT, protease inhibitor cocktail

Following IMAC, size exclusion chromatography should be performed to ensure homogeneity of the protein sample. Throughout the purification process, it is essential to monitor protein functionality using binding assays to confirm that the native conformation is preserved .

How can I engineer phnU protein to enhance its stability for structural studies?

Enhancing the stability of phnU for structural studies requires strategic protein engineering approaches. Several techniques can be implemented:

  • Removal of flexible regions: Identify and remove disordered N- and C-terminal regions or interior loops that might hinder crystallization .

  • Introduction of stabilizing mutations: Replace residues that affect solubility, particularly exposed hydrophobic residues that might promote aggregation .

  • Surface engineering: Modify surface patches to enhance crystal contact formation through rational engineering. This might involve introducing residues that promote favorable crystal packing interactions .

  • Fusion partner strategy: Incorporate a fusion partner such as T4 lysozyme or BRIL (a thermostabilized apocytochrome b562) into one of the loops to provide a rigid scaffolding that facilitates crystallization.

A systematic approach would involve creating a library of constructs with various modifications and screening them for expression, stability, and homogeneity. Thermal shift assays can be utilized to identify constructs with enhanced thermostability, which often correlates with improved crystallization properties .

What methods are most effective for analyzing phnU substrate specificity and transport kinetics?

Analyzing substrate specificity and transport kinetics of phnU requires complementary approaches:

For substrate specificity determination:

  • Scintillation proximity assay (SPA) with various potential substrates to identify binding partners .

  • Competition binding assays using a known substrate and testing various competitors.

  • Direct binding measurements with isothermal titration calorimetry (ITC) or microscale thermophoresis (MST).

For transport kinetics analysis:

  • Reconstitution of purified phnU into proteoliposomes for substrate uptake studies .

  • Determination of transport rates at varying substrate concentrations to establish Km and Vmax parameters.

  • Assessment of Na+ or H+ dependence by varying ionic conditions.

Kinetic ParameterMeasurement MethodExpected Range
Substrate Binding Affinity (Kd)SPA, ITC, or MSTLow μM to high nM range
Transport Rate (Vmax)Proteoliposome uptake assayspmol/min/mg protein
Sodium Dependence (K0.5 Na+)Varying [Na+] in binding/transport assays1-100 mM
pH DependencyAssays at different pH valuesOptimal pH likely 6.5-7.5

It's crucial to distinguish between binding affinity and transport kinetics, as the electrochemical gradient significantly impacts transport parameters in intact cells compared to detergent-solubilized proteins .

What approaches can be used to determine the three-dimensional structure of phnU?

Determining the three-dimensional structure of phnU requires a multi-faceted approach given the challenges associated with membrane protein structural studies:

  • X-ray Crystallography: This remains a gold standard for high-resolution structures. For phnU, optimizing crystallization conditions would involve:

    • Screening multiple detergents and lipid additives

    • Testing various constructs with modified termini or loop regions

    • Using crystallization chaperones or antibody fragments

    • Incorporation of selenium-methionine for phasing

  • Cryo-Electron Microscopy (Cryo-EM): Increasingly powerful for membrane proteins, particularly when:

    • Reconstituted into nanodiscs to maintain a native-like lipid environment

    • Combined with antibody fragments to increase particle size and provide fiducial markers

  • Integrative Structural Biology: Combining multiple techniques:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map solvent-accessible regions

    • Cross-linking mass spectrometry to determine spatial relationships

    • Molecular dynamics simulations based on homology models

For initial phasing in crystallographic studies, selenomethionine incorporation during expression provides an effective method for obtaining phase information through multi-wavelength anomalous dispersion (MAD) experiments .

How does phnU compare structurally and functionally to other members of the phosphonate transport system?

PhnU functions as part of the phosphonate transport system, which typically includes multiple components. Comparative analysis reveals:

ProteinStructural FeaturesFunctional RoleOrganism Variation
PhnUPermease protein, multiple transmembrane domainsForms transmembrane channelHighly conserved across gram-negative bacteria
PhnCATP-binding componentProvides energy for transport through ATP hydrolysisContains Walker A and B motifs for ATP binding
PhnEPermease proteinForms transmembrane channel with PhnUInteracts directly with PhnU
PhnDSubstrate-binding proteinInitial substrate recognitionHighest substrate specificity determinant

Unlike many other transporter families that have been extensively characterized (such as the NSS family members like Tyt1 or LeuT), the phosphonate transporters have received less structural attention . Functional studies suggest that phosphonate transporters operate through an ATP-binding cassette (ABC) transport mechanism, with PhnU and PhnE forming the transmembrane domain, PhnC providing the nucleotide-binding domain, and PhnD serving as the substrate-binding protein.

How can molecular dynamics simulations enhance our understanding of phnU transport mechanisms?

Molecular dynamics (MD) simulations provide valuable insights into the dynamic behavior of phnU and its transport mechanism:

  • Transport Pathway Identification: MD simulations can reveal the pathway through which 2-aminoethylphosphonate traverses the membrane via phnU. This includes:

    • Identifying key residues that line the transport channel

    • Determining potential energy barriers along the transport pathway

    • Elucidating conformational changes associated with substrate translocation

  • Na⁺ Coupling Mechanism: For sodium-coupled transporters like phnU, simulations can clarify:

    • Na⁺ binding sites within the protein structure

    • The sequence of binding events (Na⁺ binding before or after substrate)

    • How Na⁺ binding triggers conformational changes

  • Alternating Access Mechanism: MD simulations can model the transitions between:

    • Outward-facing conformations that can accept substrate from the periplasm

    • Occluded states where substrate is bound but inaccessible from either side

    • Inward-facing conformations that release substrate to the cytoplasm

To conduct meaningful MD simulations, the protein should be embedded in a lipid bilayer that mimics the bacterial membrane composition, and the system should include explicit water molecules and ions at physiological concentrations. Simulations typically need to run for microsecond timescales to capture relevant conformational changes, often requiring specialized computing resources .

What are the common challenges in expressing functional phnU and how can they be overcome?

Expression of functional membrane transport proteins like phnU presents several challenges:

  • Toxicity to Host Cells: Overexpression of membrane proteins can disrupt membrane integrity and cellular function.

    • Solution: Use specialized E. coli strains designed for membrane protein expression (C41/C43), utilize tightly controlled induction systems, or reduce expression temperature (16-20°C) .

  • Improper Membrane Insertion: Membrane proteins must be correctly inserted into the membrane to function.

    • Solution: Co-expression with chaperones (GroEL/ES), inclusion of fusion partners that assist membrane targeting, or use of weaker promoters to slow protein synthesis.

  • Protein Misfolding and Aggregation: Membrane proteins often misfold when overexpressed.

    • Solution: Addition of chemical chaperones (glycerol, DMSO at low concentrations), expression at lower temperatures, or fusion with solubility-enhancing tags.

  • Lack of Function Verification: Many expressed transporters are non-functional despite being detected by protein assays .

    • Solution: Implement functional assays early in the purification process, such as substrate binding assays using SPA methodology.

ChallengeIndicatorStrategy
Low ExpressionWeak band on Western blotOptimize codon usage, adjust induction conditions
Inclusion BodiesProtein in insoluble fractionLower expression temperature, add solubilizing additives
Poor Membrane IntegrationProtein extracted with mild detergentsUse signal sequences optimized for membrane targeting
Non-functional ProteinNo substrate bindingScreen multiple constructs and expression conditions

A comparative approach testing various expression conditions simultaneously can efficiently identify optimal parameters for producing functional phnU .

How can I design experiments to investigate the role of specific residues in phnU function?

Investigating the functional importance of specific residues in phnU requires a systematic mutagenesis approach:

  • Identification of Target Residues:

    • Conserved residues identified through multiple sequence alignment of phnU homologs

    • Residues lining potential substrate binding sites based on homology models

    • Charged residues within transmembrane regions that might participate in ion coupling

  • Mutagenesis Strategy:

    • Alanine scanning: Replace selected residues with alanine to remove side chain functionality

    • Conservative substitutions: Maintain similar properties but alter specificity (e.g., Asp to Glu)

    • Cysteine substitutions: For subsequent accessibility studies using thiol-reactive reagents

  • Functional Assessment:

    • Substrate binding assays using SPA to determine effects on binding affinity

    • Transport assays in reconstituted proteoliposomes to assess transport activity

    • Thermostability measurements to evaluate structural integrity of mutants

  • Structural Context Evaluation:

    • Cross-linking studies to determine proximity relationships between residues

    • Accessibility studies using membrane-permeable and impermeable reagents

    • Conformational change assessment using engineered fluorescent probes or EPR spectroscopy

A methodical approach would involve creating a library of single-site mutants covering key regions of the protein, followed by comprehensive characterization of their expression, folding, stability, and function .

What are the best approaches for reconstituting purified phnU into proteoliposomes for functional studies?

Reconstitution of phnU into proteoliposomes is critical for functional transport studies:

  • Liposome Preparation:

    • Use lipid compositions that mimic bacterial membranes (e.g., mixture of phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin)

    • Prepare unilamellar vesicles by extrusion through polycarbonate filters (100-400 nm pore size)

    • Ensure buffer conditions inside vesicles support transport measurement (e.g., pH-sensitive fluorescent dyes for proton-coupled transport)

  • Protein Incorporation Methods:

    • Detergent-mediated reconstitution: Mix purified protein with detergent-destabilized liposomes and remove detergent slowly using Bio-Beads or dialysis

    • Direct incorporation: Add purified protein during liposome formation with subsequent detergent removal

    • Reconstitution into nanodiscs for single-molecule studies

  • Optimization Parameters:

    ParameterOptimization RangeImpact
    Protein:Lipid Ratio1:50 to 1:2000 (w/w)Affects transporter density and orientation
    Detergent TypeDDM, OG, Triton X-100Influences reconstitution efficiency
    Detergent Removal Rate2-48 hoursAffects vesicle formation and protein orientation
    Buffer CompositionpH 6.5-8.0, 10-300 mM saltImpacts protein stability during reconstitution
  • Functional Verification:

    • Substrate uptake assays using radiolabeled compounds

    • Counterflow assays to verify bidirectional transport

    • Measurement of coupling ion dependencies

The optimal reconstitution protocol should be determined empirically, as membrane proteins vary in their requirements for successful incorporation into artificial membranes. A critical control is to verify that transport is protein-mediated by using specific inhibitors or by comparing with proteoliposomes lacking the transporter .

How can phnU be utilized as a model system for studying membrane transport mechanisms?

PhnU offers several advantages as a model system for studying fundamental aspects of membrane transport:

  • Structural Insights into Transport Mechanisms:

    • As part of the phosphonate transport system, phnU represents an important class of bacterial nutrient importers

    • Structural studies of phnU can reveal conserved features of membrane transport proteins

    • Comparison with other transporters can highlight diverse evolutionary solutions to the membrane transport challenge

  • Investigation of Coupling Mechanisms:

    • Studies can elucidate how ion gradients (Na⁺ or H⁺) are coupled to substrate transport

    • The conformational changes associated with alternating access can be mapped

    • Single-molecule techniques can reveal the dynamic behavior of the transport cycle

  • Experimental Advantages:

    • Expression in E. coli provides a readily available source of protein

    • His-tagged constructs allow for efficient purification

    • The bacterial origin may result in greater stability compared to eukaryotic transporters

    • The phosphonate substrate can be synthesized with various modifications for mechanistic studies

The scintillation proximity assay (SPA) methodology developed for other transporters can be directly applied to phnU, allowing for high-throughput screening of conditions that affect transport function and substrate specificity .

What strategies can be employed to identify inhibitors or modulators of phnU activity?

Identification of inhibitors or modulators of phnU activity can provide valuable tools for studying transport mechanisms and potentially lead to new antimicrobial strategies:

  • High-Throughput Screening Approaches:

    • Adaptation of the SPA binding assay for compound library screening

    • Development of fluorescence-based transport assays for whole-cell screening

    • Virtual screening using computational docking when structural data becomes available

  • Rational Design Strategies:

    • Substrate analogs that competitively inhibit transport

    • Compounds targeting the ion binding sites to disrupt coupling

    • Molecules that stabilize specific conformational states

  • Structure-Activity Relationship Studies:

    • Systematic modification of identified hit compounds

    • Photoaffinity labeling to identify binding sites

    • Fragment-based approaches to develop high-affinity ligands

  • Allosteric Modulators:

    • Screening for compounds that bind outside the substrate binding site

    • Identification of molecules that alter the transport kinetics without competing with substrate

    • Investigation of lipid modulators that affect protein function through membrane interactions

The scintillation proximity assay provides a particularly powerful platform for inhibitor discovery as it can be performed with crude membrane extracts or purified protein, allowing for rapid screening without the need for reconstitution into proteoliposomes for initial hit identification .

How does the phosphonate transport system contribute to bacterial pathogenesis and antimicrobial resistance?

The phosphonate transport system, including phnU, plays multiple roles in bacterial physiology with implications for pathogenesis and antimicrobial resistance:

  • Nutrient Acquisition during Infection:

    • Phosphonates serve as alternative phosphorus sources during phosphate limitation

    • Host environments often restrict available phosphate as a defense mechanism

    • Salmonella typhi may utilize the phn system to access host phosphonates during infection

  • Contribution to Antimicrobial Resistance:

    • Some antibiotics contain phosphonate groups (e.g., fosfomycin)

    • Transport systems may contribute to uptake or efflux of antimicrobial compounds

    • Mutations in transport systems can alter susceptibility to certain antibiotics

  • Bacterial Metabolism and Virulence:

    • Phosphonate metabolism pathways are linked to central metabolic processes

    • Disruption of phosphonate transport may attenuate virulence in nutritionally restricted environments

    • The phn system may contribute to biofilm formation under certain conditions

AspectSignificanceResearch Implication
Nutrient AcquisitionEssential during phosphate limitationPotential target for antimicrobial development
Metabolic IntegrationConnected to central metabolic pathwaysSystem biology approaches needed
Host InteractionMay access host-derived phosphonatesIn vivo models required to fully understand role
Biofilm ContributionMay affect surface attachmentBiofilm models necessary for evaluation

Understanding the role of phnU in these processes requires sophisticated experimental approaches combining genetics, biochemistry, and in vivo infection models. The development of specific inhibitors of phnU function could provide valuable tools for investigating these aspects of bacterial physiology and potentially lead to new therapeutic strategies.

What are the key unresolved questions regarding phnU structure and function?

Despite advances in membrane protein research, several critical questions about phnU remain unresolved:

  • Structural Details: The high-resolution structure of phnU has not been determined, leaving questions about the precise arrangement of transmembrane helices, the nature of the substrate binding site, and the conformational changes associated with transport.

  • Transport Mechanism: The exact mechanism of phosphonate transport, including whether it follows an alternating access model similar to other transporters, remains to be fully elucidated.

  • Subunit Interactions: How phnU interacts with other components of the phosphonate transport system (particularly phnE) to form a functional transport complex requires further investigation.

  • Regulatory Mechanisms: The factors that regulate phnU expression and activity in response to environmental conditions, particularly phosphate availability, are not fully understood.

  • Substrate Specificity: The range of phosphonate compounds that can be transported by the system and the structural determinants of this specificity remain to be comprehensively characterized.

Addressing these questions will require integrated approaches combining structural biology, biochemistry, and cellular physiology .

How might emerging technologies advance our understanding of phnU and related transport proteins?

Emerging technologies offer exciting opportunities to address longstanding challenges in transport protein research:

  • Advanced Structural Methods:

    • Cryo-electron microscopy with improved detectors and processing algorithms

    • Micro-electron diffraction (MicroED) for structure determination from nanocrystals

    • Serial femtosecond crystallography using X-ray free electron lasers

  • Single-Molecule Techniques:

    • Single-molecule FRET to monitor conformational dynamics

    • High-speed atomic force microscopy to visualize structural changes

    • Nanodiscs and polymer-based membrane mimetics for stabilizing native conformations

  • Computational Approaches:

    • Enhanced sampling methods for simulating rare transport events

    • Machine learning for predicting functional sites and transport mechanisms

    • Artificial intelligence-assisted protein engineering

  • In-Cell Structural Biology:

    • Genetic code expansion for site-specific incorporation of probes

    • In-cell NMR and EPR spectroscopy

    • Correlative light and electron microscopy

  • Systems Biology Integration:

    • Multi-omics approaches linking transporter function to cellular physiology

    • Synthetic biology platforms for engineered transport systems

    • CRISPR-based methods for studying transporter function in native contexts

These technologies promise to provide unprecedented insights into the dynamic behavior of phnU and other membrane transporters, bridging the gap between static structural snapshots and the functional transport cycle .

What interdisciplinary approaches are most promising for comprehensive characterization of bacterial transport systems?

Comprehensive characterization of bacterial transport systems like phnU benefits from interdisciplinary approaches:

  • Structural Biology and Biophysics:

    • X-ray crystallography, cryo-EM, and NMR for structural determination

    • Spectroscopic methods (EPR, FRET) for dynamics

    • Calorimetry and surface plasmon resonance for interaction studies

  • Biochemistry and Molecular Biology:

    • In vitro reconstitution and transport assays

    • Mutagenesis and functional characterization

    • Protein engineering for stability and crystallizability

  • Microbiology and Cellular Biology:

    • In vivo transport studies in bacterial systems

    • Growth assays under varying nutrient conditions

    • Biofilm and infection models

  • Computational Sciences:

    • Molecular dynamics simulations

    • Bioinformatics for sequence-structure-function relationships

    • Systems biology modeling of transport processes

  • Chemical Biology:

    • Development of specific inhibitors and probes

    • Synthesis of substrate analogs

    • Photocrosslinking for interaction mapping

Integration of these diverse approaches provides complementary insights that no single method can achieve alone. For example, high-resolution structures inform the design of functional experiments, while functional data guide structural studies to capture physiologically relevant conformations. Similarly, computational predictions can be validated through experimental approaches, creating an iterative process that drives deeper understanding of transport mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.