Recombinant Putative ABC transporter permease protein ORF1

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
Putative ABC transporter permease protein ORF1; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Streptomyces antibioticus
Target Protein Sequence
IPRHPTLANVRQAFAEQPLAHAALNSLLVALATAAVTVLIATPMAYVMARHRTKAARAAT GWVVVSQAFPFVLLIIPLFLVLKRLRLIDSLTGLVLVYVVWSLPFALWMLAGHARAVPAE LEEAAAVDGAGRVRTLTSVTVPLLAPGIAATALFAFVTAWNEFFFALVLLKSPHRQTLPV VLTHFIGAEGVPTSPAGAAAFLATLPSLAFFALVQRRITSGLLTGAVKN
Uniprot No.

Target Background

Function
This protein may be involved in oleandomycin secretion during antibiotic production.
Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the ORF1 permease component integrate with other ABC transporter subunits to form a functional complex?

The putative ABC transporter permease protein ORF1 functions as part of a multicomponent ABC transporter system. Typically, ABC transporters consist of two main domains: the transmembrane domains (TMDs), which provide the substrate translocation pathway, and the nucleotide-binding domains (NBDs), which bind and hydrolyze ATP to drive transport.

The ORF1 protein serves as the transmembrane component (permease) that forms the channel through which substrates pass. For complete functionality, it must associate with ATP-binding components that provide the energy for active transport. This association typically involves specific protein-protein interactions between the permease and the ATP-binding domains . Based on studies of similar ABC transporters, these components likely assemble into a tetramer or higher-order complex to create a functional transporter unit .

What expression systems are optimal for producing functional Recombinant Putative ABC transporter permease protein ORF1?

For successful expression of functional Recombinant Putative ABC transporter permease protein ORF1, E. coli has been demonstrated as an effective heterologous expression system. The protein is typically expressed with an N-terminal His-tag to facilitate purification.

The recommended expression protocol includes:

  • Cloning the full-length gene (encoding amino acids 1-229) into an expression vector with an N-terminal His-tag

  • Transforming the construct into an E. coli expression strain

  • Inducing expression under controlled conditions

  • Harvesting cells and lysing them to extract the recombinant protein

This approach has yielded functional protein with >90% purity as determined by SDS-PAGE analysis .

What are the critical considerations for maintaining stability and activity of the purified protein?

The stability and activity of purified Recombinant Putative ABC transporter permease protein ORF1 depend on several key factors:

Storage ParameterRecommended ConditionNotes
Storage Temperature-20°C/-80°CAliquoting necessary for multiple use
Buffer CompositionTris/PBS-based buffer with 6% Trehalose, pH 8.0Optimized for stability
Short-term Storage4°CUp to one week for working aliquots
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Add 5-50% glycerol for long-term storage
Freeze-thaw CyclesMinimizeRepeated freezing and thawing not recommended

For functional studies, reconstitution into lipid bilayers or detergent micelles may be necessary to maintain the native conformation of this membrane protein. The addition of 50% glycerol to the storage buffer has been shown to enhance long-term stability .

What experimental approaches can be used to assess the transport activity of Recombinant Putative ABC transporter permease protein ORF1?

Multiple complementary approaches can be used to characterize the transport activity:

  • ATPase Activity Assays: Measuring ATP hydrolysis rates can provide indirect evidence of transporter function. Similar to other ABC transporters, the ATPase activity can be measured using colorimetric phosphate release assays or coupled enzyme assays.

  • Substrate Transport Assays: Reconstituting the protein into liposomes and measuring substrate uptake or efflux. This typically involves fluorescently labeled substrates or radiolabeled compounds.

  • Fluorescent Probe-Based Assays: Using fluorescent substrates such as those developed for studying multidrug resistance ABC transporters. These probes have shown high sensitivity for detecting functional efflux activity .

  • Genetic Complementation Studies: Expressing the transporter in knockout strains lacking endogenous transporters and assessing phenotype restoration, similar to approaches used with AatA in acetic acid resistance studies .

How can researchers distinguish between specific substrate transport and non-specific effects when characterizing ABC transporter function?

To differentiate between specific substrate transport and non-specific effects:

  • Use of Transport Inhibitors: Employ specific ABC transporter inhibitors to confirm that observed transport is mediated by the protein of interest.

  • Site-Directed Mutagenesis: Introduction of mutations in key conserved residues, particularly in the Walker A and B motifs or H-loops that are essential for ATP hydrolysis. For example, mutating conserved residues like E170 in the Walker B motif or H203 in the H-loop has been shown to abolish function in related transporters .

  • Substrate Competition Assays: Perform competition assays with known substrates to determine specificity.

  • Controls with Non-functional Protein Variants: Compare transport rates with proteins containing mutations in critical functional domains.

  • Comparative Analysis with Related Transporters: Compare functional properties with well-characterized ABC transporters to identify unique characteristics .

What insights have crystallographic studies provided about the mechanism of substrate translocation in ABC transporters similar to ORF1?

Crystal structures of related ABC transporters have revealed critical insights about substrate translocation mechanisms that may apply to ORF1:

  • Substrate Entry Window: Structural studies of the ABC transporter AaPrtD from Aquifex aeolicus revealed a substrate entry window positioned above the nucleotide binding domains, which likely serves as the initial binding site for substrates .

  • Transmembrane Channel Architecture: The presence of highly kinked transmembrane helices that form a narrow channel distinct from canonical peptide transporters. These structural features suggest that ABC transporters like ORF1 employ a polypeptide transport mechanism distinct from the alternating access model commonly associated with other transporters .

  • ATP Binding and Hydrolysis Coupling: Crystal structures have demonstrated how ATP binding and hydrolysis are coupled to conformational changes in the transmembrane domains, providing the mechanical force for substrate translocation.

Understanding these structural features provides a framework for investigating the specific mechanism of ORF1 permease function .

How do mutations in conserved domains affect the function of ABC transporter permease proteins?

Mutations in conserved domains of ABC transporter permease proteins have profound effects on function:

  • Walker A/B Motifs: Mutations in these ATP-binding motifs, such as the K788M mutation in the Walker A motif of related ABC transporters, abolish ATP hydrolysis and consequently transport function .

  • Transmembrane Domains: Alterations in the transmembrane helices can disrupt the transport channel and substrate specificity.

  • Coupling Helices: Mutations in the coupling helices that connect the transmembrane domains with the nucleotide-binding domains can uncouple ATP hydrolysis from substrate transport.

Experimental approaches to investigate these effects include site-directed mutagenesis followed by functional assays to measure transport activity, ATP hydrolysis, and substrate binding .

How does Putative ABC transporter permease protein ORF1 compare with other bacterial ABC transporters in terms of sequence conservation and functional domains?

The Putative ABC transporter permease protein ORF1 shows significant sequence homology with several members of the ABC transporter family. Comparative analysis reveals:

  • Sequence Conservation: The protein contains conserved motifs characteristic of ABC transporter permease components, including transmembrane domains and substrate-binding regions.

  • Unique Features: Unlike some ABC transporters that have a single ATP-binding site, related transporters may have two distinct putative ATP-binding sites, suggesting a potentially unique mechanism of action .

  • Evolutionary Relationships: Phylogenetic analysis places this protein among bacterial ABC transporters involved in various transport functions, including resistance to antibiotics and other toxic compounds.

Homology modeling based on crystal structures of related ABC transporters can provide further insights into its structural and functional features .

What orthologues of Putative ABC transporter permease protein ORF1 exist in different bacterial species, and how do they contribute to various physiological functions?

Southern blot analysis and nucleotide sequencing have predicted the presence of orthologues in various acetic acid bacteria belonging to the genera Acetobacter and Gluconacetobacter . These orthologues contribute to diverse physiological functions:

  • Acetic Acid Resistance: Orthologues like AatA in Acetobacter aceti confer acetic acid resistance, allowing bacteria to survive in acidic environments. Expression of AatA on a multicopy plasmid has been shown to increase final acetic acid yields during fermentation .

  • Antibiotic Resistance: Related ABC transporters mediate resistance to various antibiotics by actively exporting these compounds from bacterial cells .

  • Substrate Specificity Variation: Despite structural similarities, orthologues often show variations in substrate specificity, reflecting adaptations to different ecological niches and environmental challenges.

These orthologues provide valuable comparative models for understanding the function of ORF1 and may offer insights into the evolution of ABC transporters in bacteria .

How can Recombinant Putative ABC transporter permease protein ORF1 be utilized in studies of bacterial resistance mechanisms?

Recombinant Putative ABC transporter permease protein ORF1 provides a valuable tool for investigating bacterial resistance mechanisms:

  • Resistance Mechanism Elucidation: By characterizing its transport specificity, researchers can identify potential substrates that might contribute to resistance phenotypes.

  • Inhibitor Development: The purified protein can be used in screening assays to identify potential inhibitors that might reverse resistance mediated by ABC transporters.

  • Structure-Based Drug Design: Structural studies of the recombinant protein can inform the design of compounds that specifically target ABC transporters involved in resistance.

  • Heterologous Expression Studies: Expression of the transporter in susceptible strains can assess its ability to confer resistance to specific compounds, similar to how pABC101 conferred acetic acid resistance on E. coli .

  • Regulatory Studies: Investigation of regulatory elements controlling expression, such as the identified PhoPQ two-component system that regulates related ABC transporter operons .

What role do ABC transporters like ORF1 play in cancer multidrug resistance, and how can this information guide therapeutic strategies?

While ORF1 is a bacterial protein, understanding its mechanism provides insights relevant to eukaryotic ABC transporters involved in cancer multidrug resistance (MDR):

  • Structural Homology: Bacterial ABC transporters share structural features with eukaryotic counterparts implicated in MDR, such as P-glycoprotein (ABCB1), MRP1/2 (ABCC1/2), and BCRP/MXR (ABCG2) .

  • Transport Mechanism Insights: Mechanistic studies of bacterial ABC transporters can elucidate conserved principles of substrate recognition and translocation applicable to human ABC transporters.

  • Inhibitor Development Strategies: Approaches to inhibit bacterial ABC transporters may inform strategies to overcome MDR in cancer.

  • Expression Regulation: Understanding how ABC transporter expression is regulated in bacteria may provide insights into dysregulation mechanisms in cancer cells.

Research has shown that ABC transporters are intensely studied for their involvement in MDR, especially in cancer, with some transporters showing overexpression in tumors compared to normal tissues .

What are the major technical challenges in working with membrane proteins like ABC transporters, and how can they be addressed?

Working with membrane proteins presents several technical challenges:

ChallengeSolution Approach
Protein SolubilityUse of appropriate detergents or lipid nanodiscs for extraction and stabilization
Maintaining Native ConformationReconstitution into liposomes or nanodiscs that mimic the native membrane environment
Low Expression YieldsOptimization of expression conditions, use of specialized expression strains, or alternative expression systems
Protein AggregationAddition of stabilizing agents like glycerol or trehalose to storage buffers
Functional AssessmentDevelopment of robust activity assays specific to the transporter's function

For Recombinant Putative ABC transporter permease protein ORF1 specifically, using a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 and adding 50% glycerol for long-term storage has been shown to maintain stability .

How can researchers effectively integrate structural, biochemical, and genetic approaches to comprehensively characterize ABC transporter function?

A multidisciplinary approach is essential for comprehensive characterization:

  • Structural Studies: X-ray crystallography, cryo-electron microscopy, or homology modeling based on related transporters with known structures.

  • Biochemical Characterization:

    • ATPase activity assays to measure the rate of ATP hydrolysis

    • Transport assays using fluorescent or radiolabeled substrates

    • Binding studies to identify interaction partners and substrates

  • Genetic Approaches:

    • Site-directed mutagenesis to identify critical residues

    • Gene knockout/complementation studies to assess physiological roles

    • Transcriptional regulation analysis to understand expression control

  • Computational Methods:

    • Molecular dynamics simulations to study conformational changes

    • Docking studies to identify potential substrates

    • Sequence analysis to identify conserved motifs

  • Integration Framework: Developing models that incorporate data from all approaches to build a comprehensive understanding of transporter function .

An example of successful integration is seen in studies where mutations in the conserved Walker motifs identified through sequence analysis were experimentally verified to abolish ATP hydrolysis in related transporters .

What emerging technologies might advance our understanding of ABC transporter structure and function beyond current methodological limitations?

Several emerging technologies hold promise for advancing ABC transporter research:

  • High-Resolution Cryo-EM: Recent advances in cryo-electron microscopy now allow visualization of membrane proteins in various conformational states, potentially revealing the complete transport cycle.

  • Single-Molecule Techniques: Methods such as single-molecule FRET can track conformational changes in real-time during the transport cycle.

  • Native Mass Spectrometry: This technique can reveal the stoichiometry and interaction dynamics of ABC transporter complexes in near-native conditions.

  • Advanced Computational Approaches: Machine learning and artificial intelligence methods are increasingly used to predict protein structures, substrate specificity, and functional relationships.

  • Spectrally Resolved FRET: This technique has been used to investigate the quaternary structure of ABC transporters in living cells, providing insights into their assembly and dynamics that are not possible with traditional structural biology approaches .

What is the potential role of ABC transporters in synthetic biology applications, and how might engineered variants of proteins like ORF1 contribute to biotechnology?

ABC transporters offer significant potential for synthetic biology applications:

  • Biomanufacturing: Engineered ABC transporters could facilitate the export of valuable biological products from production organisms, improving yields and simplifying purification.

  • Biosensors: Modified transporters could be developed as biosensors for specific compounds, utilizing conformational changes or ATPase activity as readouts.

  • Metabolic Engineering: Strategic expression of transporters can enhance cellular tolerance to toxic metabolites or products, improving the viability of engineered production strains.

  • Drug Delivery Systems: Knowledge from bacterial ABC transporters could inform the design of delivery systems that overcome transport barriers in therapeutic applications.

  • Resistance Management: Understanding and manipulating ABC transporters could lead to strategies for controlling antibiotic resistance in pathogenic bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.