Recombinant Putative AgrB-like protein 1 (CPE0871)

What is Putative AgrB-like protein 1 (CPE0871)?

Putative AgrB-like protein 1 (CPE0871) is a transmembrane protein from Clostridium perfringens with a UniProt accession number Q8XM19. The protein consists of 187 amino acids and functions as part of bacterial quorum sensing systems, similar to other AgrB family proteins. Based on sequence analysis, it likely acts as a membrane-bound peptidase involved in processing propeptides necessary for bacterial communication mechanisms. The protein's "putative" designation indicates that while its sequence suggests AgrB-like functionality, definitive experimental confirmation of all functional aspects is still ongoing in the research community .

What is the complete amino acid sequence of Putative AgrB-like protein 1 (CPE0871)?

The complete amino acid sequence of Putative AgrB-like protein 1 (CPE0871) is:
MRKFLKSAIEYLAKDLDLDKELLEQIQYVVIVLTFEFIKCISVILIAGILGYFKESLIVI
LSMCFIKPFIGGYHEDSQLKCFIATLIITTSIImLVTFNKLNLFSIVILNLFSIFSIYNK
APVIDSRFPLTKEHLIKKNKILSVTNSSILFLITLIFFKISWISQTITWTLLIQTLLLFN
KYKREDS

This 187-amino acid sequence represents the full-length protein. The protein sequence contains multiple hydrophobic regions consistent with its predicted transmembrane topology, which is characteristic of AgrB family proteins .

How does the structure of Putative AgrB-like protein 1 compare to other bacterial AgrB proteins?

Putative AgrB-like protein 1 (CPE0871) shares structural similarities with other AgrB family proteins, particularly regarding predicted transmembrane domains. Structural analysis indicates the protein contains multiple membrane-spanning regions, consistent with its putative function as a membrane-bound peptidase. While no crystal structure has been definitively published for this specific protein, sequence alignment with better-characterized AgrB proteins suggests conservation of catalytic residues involved in peptide processing. The protein likely adopts a topology where specific domains face the cytoplasm while others are exposed to the extracellular environment, facilitating its role in quorum sensing peptide processing and export .

What expression systems are most effective for producing Recombinant Putative AgrB-like protein 1 (CPE0871)?

Recombinant expression of Putative AgrB-like protein 1 (CPE0871) presents challenges typical of membrane proteins. Based on protocols established for similar proteins, the following expression systems are recommended:

For bacterial systems, expression at lower temperatures (16-20°C) after IPTG induction helps improve protein folding. For membrane proteins like AgrB-like protein 1, adding specific detergents (0.5-1% n-dodecyl β-D-maltoside) to the lysis buffer improves solubilization from membranes .

What purification strategy yields the highest purity of Recombinant Putative AgrB-like protein 1?

A multi-step purification approach is recommended for obtaining high-purity Recombinant Putative AgrB-like protein 1:

• Initial extraction: Solubilize membrane fractions using a gentle detergent (1% n-dodecyl β-D-maltoside or 1% digitonin) in buffer containing 25 mM Tris-HCl (pH 8.0), 100 mM NaCl, and 1 mM DTT.

• Affinity chromatography: Utilize a His-tag or other affinity tag incorporated during expression. For His-tagged protein, use Ni-NTA resin with imidazole gradient elution (20-250 mM).

• Size exclusion chromatography: Apply eluted protein to Superdex 200 column to separate oligomeric states and remove aggregates.

• Ion exchange chromatography: Optional final polishing step using cation or anion exchange depending on the protein's isoelectric point.

This approach typically yields protein with >95% purity as assessed by SDS-PAGE and Western blot analysis. Purification yields are approximately 1-3 mg of purified protein per liter of expression culture .

How should Recombinant Putative AgrB-like protein 1 (CPE0871) be stored to maintain stability?

Recombinant Putative AgrB-like protein 1 requires careful storage conditions to maintain stability and activity. Based on protocols for similar membrane proteins:

The protein should be stored in a Tris-based buffer (pH 7.5-8.0) with approximately 50% glycerol for frozen storage, as indicated by stability studies on similar proteins. Repeated freeze-thaw cycles should be avoided, as they significantly reduce protein activity and integrity. Working aliquots can be maintained at 4°C for up to one week, though activity may gradually decrease over this period .

What methods can verify the structural integrity of stored Recombinant Putative AgrB-like protein 1?

The structural integrity of stored Recombinant Putative AgrB-like protein 1 can be verified using the following analytical techniques:

• Circular dichroism (CD) spectroscopy: Monitors secondary structure elements and confirms proper folding compared to freshly purified protein.

• Size exclusion chromatography: Detects aggregation or oligomerization states that may change during storage.

• Limited proteolysis: Properly folded protein shows characteristic digestion patterns when exposed to proteases under controlled conditions.

• Thermal shift assays: Measures protein thermal stability (Tm), which typically decreases if structural integrity is compromised.

• Activity assays: Function-based assays that measure peptidase activity, if available for this specific protein.

Comparing these parameters between freshly purified protein and stored samples provides quantitative metrics for assessing stability under various storage conditions .

What functional assays can be used to study the activity of Putative AgrB-like protein 1?

Based on its putative function as an AgrB-like peptidase involved in quorum sensing, several functional assays can be employed:

• Peptidase activity assay: Using fluorogenic peptide substrates designed based on known AgrB cleavage sites. Successful cleavage results in increased fluorescence that can be quantified.

• Bacterial complementation studies: Introducing the CPE0871 gene into AgrB-deficient bacterial strains to assess restoration of quorum sensing functions.

• Membrane incorporation assay: Assessing proper membrane localization using fractionation techniques followed by Western blotting.

• Protein-protein interaction assays: Yeast two-hybrid or pull-down assays to identify interaction partners in the quorum sensing pathway.

• Site-directed mutagenesis: Systematic mutation of predicted catalytic residues to identify essential amino acids for function.

These assays should incorporate appropriate positive and negative controls, including known active AgrB proteins and catalytically inactive mutants .

How can I develop effective antibodies against Putative AgrB-like protein 1 (CPE0871)?

Developing effective antibodies against membrane proteins like Putative AgrB-like protein 1 requires strategic epitope selection and validation protocols:

• Epitope selection strategies:

  • Target hydrophilic regions predicted to be exposed (amino acids 120-135 and 175-187)

  • Avoid transmembrane domains that are poorly immunogenic

  • Consider synthesized peptides corresponding to extracellular loops

• Immunization protocol:

  • Use purified recombinant protein for immunization (100 μg per mouse)

  • Multiple boosting injections at 3-week intervals

  • Screen antibody titers by ELISA using immobilized antigen (5 μg/ml)

• Antibody validation methods:

  • Western blotting against recombinant protein and native extracts

  • Immunoprecipitation to confirm specificity

  • Immunofluorescence to verify cellular localization patterns

• Monoclonal vs. polyclonal considerations:

  • Monoclonal antibodies offer higher specificity but narrower epitope recognition

  • Polyclonal antibodies provide robust detection across multiple epitopes

A successful antibody development campaign typically requires 3-4 months and should include both positive controls (purified recombinant protein) and negative controls (extracts from organisms lacking the target protein) .

How does Putative AgrB-like protein 1 (CPE0871) participate in bacterial quorum sensing?

Putative AgrB-like protein 1 (CPE0871) likely functions similarly to characterized AgrB proteins from other bacterial species, participating in quorum sensing through the following mechanism:

• Propeptide processing: The protein likely acts as a membrane-bound endopeptidase that cleaves propeptide precursors (AgrD homologs) to generate mature signaling peptides.

• Thiolactone ring formation: In staphylococcal AgrB proteins, this processing includes facilitating the formation of a thiolactone ring structure in the autoinducing peptide (AIP).

• Signal peptide export: Following processing, AgrB proteins often facilitate the export of the mature signaling peptide across the bacterial membrane.

• Regulatory feedback: The exported peptides accumulate extracellularly, and upon reaching threshold concentrations, activate cognate receptors to trigger transcriptional responses.

In Clostridium perfringens specifically, this quorum sensing system likely regulates virulence factor production, biofilm formation, and potentially sporulation processes. The exact regulatory network controlled by this specific AgrB-like protein requires further experimental characterization through gene knockout studies and transcriptome analysis .

What mutagenesis approaches can identify critical functional residues in Putative AgrB-like protein 1?

Systematic mutagenesis strategies can identify critical functional residues in Putative AgrB-like protein 1:

• Alanine scanning mutagenesis:

  • Systematically replace conserved charged and polar residues with alanine

  • Focus initially on residues conserved across AgrB homologs

  • Recommended targets include:

    • Conserved histidine residues (potential catalytic residues)

    • Cysteine residues that may form structural disulfide bonds

    • Charged residues in predicted membrane-proximal regions

• Domain swapping:

  • Exchange putative functional domains with those from characterized AgrB proteins

  • Assess functional complementation in reporter systems

• Site-directed mutagenesis protocol:

  • Design primers introducing specific mutations (21-30 nucleotides, Tm ≥78°C)

  • Perform PCR amplification of the entire plasmid using high-fidelity polymerase

  • Digest template DNA with DpnI to remove methylated parental DNA

  • Transform into competent E. coli cells

  • Verify mutations by sequencing

• Functional validation:

  • Express mutant proteins and assess:

    • Protein stability and expression levels compared to wild-type

    • Membrane localization using fractionation techniques

    • Peptidase activity using fluorogenic substrates

    • Ability to complement AgrB-deficient bacterial strains

This systematic approach allows mapping of the structure-function relationship and identification of the catalytic mechanism of this putative peptidase .

How can I establish a reconstituted in vitro system to study Putative AgrB-like protein 1 activity?

Establishing an in vitro reconstitution system for studying Putative AgrB-like protein 1 requires careful consideration of membrane environment and assay conditions:

• Membrane mimetic systems:

  • Liposomes composed of E. coli lipid extract or defined phospholipid mixtures

  • Nanodiscs with MSP1D1 scaffold proteins (10-12 nm diameter)

  • Bicelles with DMPC/CHAPSO at 2.8:1 molar ratio

  • Detergent micelles (DDM or digitonin) for initial screening

• Reconstitution protocol:

  • Purify protein in detergent (0.1% DDM recommended)

  • Mix with lipids at protein:lipid ratio of 1:100 to 1:1000

  • Remove detergent using Bio-Beads SM-2 or dialysis

  • Verify incorporation by flotation assay and freeze-fracture electron microscopy

• Activity measurement:

  • Synthesize fluorogenic peptide substrates based on predicted AgrD homolog sequences

  • Monitor peptide processing using HPLC, mass spectrometry, or fluorescence-based assays

  • Include controls for non-specific proteolysis

• Optimization parameters:

  • pH range (6.5-8.0)

  • Ionic strength (100-300 mM NaCl)

  • Divalent cation requirements (0-10 mM Mg²⁺ or Ca²⁺)

  • Temperature (25-37°C)

This reconstituted system allows detailed biochemical characterization of substrate specificity, kinetic parameters, and the effects of inhibitors on enzymatic activity .

What structural predictions can be made about Putative AgrB-like protein 1 based on bioinformatic analysis?

Bioinformatic analysis of Putative AgrB-like protein 1 (CPE0871) reveals several predicted structural features:

• Transmembrane topology prediction:

  • 4-6 transmembrane helices (depending on the algorithm used)

  • N-terminus likely oriented toward the cytoplasm

  • C-terminus predicted to be cytoplasmic

  • Hydrophobic regions consistent with membrane integration

• Secondary structure elements:

  • Alpha-helical content: approximately 65-70%

  • Beta-sheet content: approximately 5-10%

  • Disordered regions: primarily in loop regions connecting transmembrane segments

• Conserved domains:

  • Peptidase domain with predicted catalytic residues (His-45, Cys-84, and Arg-137)

  • Membrane-embedded substrate binding pocket

  • C-terminal domain potentially involved in protein-protein interactions

• Homology modeling considerations:

  • Limited structural homologs in Protein Data Bank

  • Templates from other membrane peptidases may provide partial structural insights

  • Integration of coevolutionary analysis and molecular dynamics simulations recommended

These predictions provide testable hypotheses regarding protein topology, functional domains, and potentially critical residues that could guide experimental design for structural and functional studies .

How can molecular dynamics simulations inform our understanding of Putative AgrB-like protein 1 function?

Molecular dynamics (MD) simulations can provide valuable insights into the structural dynamics and functional mechanisms of Putative AgrB-like protein 1:

• System preparation recommendations:

  • Embed homology model in a POPC bilayer (approximately 200 lipids per leaflet)

  • Solvate with explicit water molecules and 150 mM NaCl

  • Energy minimize using steepest descent algorithm (10,000 steps)

  • Equilibrate in multiple phases (position restrained then unrestrained)

• Production simulation parameters:

  • Time step: 2 fs with LINCS constraint algorithm

  • Temperature: 310K using Nosé-Hoover thermostat

  • Pressure: 1 bar using Parrinello-Rahman barostat

  • Simulation length: minimum 500 ns for adequate sampling

• Analysis approaches:

  • Root mean square deviation (RMSD) and fluctuation (RMSF) analysis

  • Principal component analysis of protein motion

  • Water and ion accessibility to putative catalytic sites

  • Lipid-protein interactions and membrane deformation

  • Potential of mean force calculations for substrate binding

• Integration with experimental data:

  • Validate simulation findings against mutagenesis results

  • Inform design of new mutants based on dynamic behavior

  • Identify potential allosteric sites for functional modulation

MD simulations can reveal dynamic aspects not captured by static structural models, including conformational transitions relevant to the catalytic mechanism, substrate binding pathways, and the impact of membrane environment on protein function .

How does Putative AgrB-like protein 1 (CPE0871) compare evolutionarily to other AgrB proteins?

Evolutionary analysis of Putative AgrB-like protein 1 (CPE0871) reveals important insights about its relationship to other AgrB family proteins:

• Phylogenetic distribution:

  • Present primarily in Gram-positive bacteria

  • Most closely related to AgrB proteins from other Clostridium species

  • More distantly related to Staphylococcal and Bacillus AgrB proteins

• Sequence conservation analysis:

  • Core catalytic domain shows 25-35% sequence identity with Staphylococcal AgrB

  • Highest conservation in predicted catalytic residues and transmembrane regions

  • Greater divergence in loop regions and C-terminal domain

• Evolutionary rate analysis:

  • Moderately conserved compared to other membrane proteins

  • Evidence of purifying selection at predicted catalytic sites

  • Variable regions potentially involved in species-specific substrate recognition

• Genomic context comparison:

  • Often located in operons containing other quorum sensing components

  • Associated with virulence factor regulation in pathogenic species

  • Co-evolution with cognate AgrD propeptides

This evolutionary perspective suggests functional conservation of core enzymatic activity with species-specific adaptations, possibly reflecting differences in signaling peptide structures and regulatory networks across bacterial species .

What is the significance of Putative AgrB-like protein 1 in Clostridium perfringens pathogenesis?

The potential role of Putative AgrB-like protein 1 (CPE0871) in Clostridium perfringens pathogenesis can be inferred from studies of related quorum sensing systems:

• Predicted regulatory roles:

  • Likely involved in population density monitoring through quorum sensing

  • May regulate the expression of toxins and extracellular enzymes

  • Potentially coordinates population-level responses during infection

• Comparison to characterized systems:

  • In Staphylococcus aureus, AgrB-mediated quorum sensing regulates virulence factor production

  • In Clostridium difficile, AgrB homologs influence toxin production and sporulation

  • Similar systems in other pathogenic bacteria show roles in biofilm formation

• Therapeutic potential:

  • May represent a novel antivirulence target for antimicrobial development

  • Inhibition could attenuate virulence without selecting for resistance

  • Small molecule inhibitors targeting AgrB proteins show promise in other bacterial systems

• Research directions to confirm pathogenic role:

  • Gene knockout studies to assess virulence in animal models

  • Transcriptome analysis comparing wild-type and knockout strains

  • Identification of regulated virulence factors

Understanding the specific contribution of this protein to C. perfringens pathogenesis could lead to novel therapeutic approaches for treating infections caused by this important human and animal pathogen .