Recombinant Putative amino-acid transporter Mb2008 (Mb2008)

Shipped with Ice Packs
In Stock

Description

Definition and Classification of Putative Amino Acid Transporters

Putative amino acid transporters are membrane proteins hypothesized to facilitate amino acid transport based on structural or genomic homology. They are often designated as "putative" until functional validation confirms their substrate specificity and transport mechanisms. Key families include:

  • APC Superfamily (TC# 2.A.3)

  • AAAP Family (TC# 2.A.18)

  • DAACS Family (TC# 2.A.23) .

These transporters are critical in nutrient sensing, cellular metabolism, and pathogen virulence (e.g., in Plasmodium and Toxoplasma) .

Recombinant Expression Systems for Amino Acid Transporters

Recombinant transporters are engineered versions expressed in heterologous systems for functional or structural studies. Common platforms include:

Expression SystemExample Applications
Pichia pastorisOverexpression of human 4F2hc-LAT1 for cancer research .
Xenopus oocytesFunctional characterization of murine mNAT (N-system transporter) .
Saccharomyces cerevisiaeComplementation assays for Histoplasma transporters (e.g., GAI1, DIP5) .

Key Features of Validated Transporters

TransporterOrganismFunctionRelevance to Mb2008
TgAAT1Toxoplasma gondiiLocalizes to PLVAC; regulates arginine transport and differentiation .Suggests lysosomal roles in pathogens.
PbAAT1Plasmodium bergheiMediates hemozoin formation; linked to cerebral malaria .Highlights transporter-drug interactions.
mNATMouseNa+^+-independent histidine/glutamine transport; liver-specific expression .Demonstrates tissue-specific roles.

Research Gaps and Hypothetical Context for Mb2008

While Mb2008 is not explicitly described in the literature, its nomenclature suggests it may belong to:

  • SLC38 Family: Linked to mTORC1 signaling and nutrient sensing (e.g., SLC38A9) .

  • Yeast-Phase Transporters: Upregulated in pathogenic fungi like Histoplasma (e.g., GAI1, FPKM = 619.46 in yeast) .

Table: Comparative Transcriptional Profiling of Histoplasma Transporters

Gene IDDesignationYeast FPKMMycelia FPKMFunction
04176GAI1619.4616.61High-affinity amino acid uptake .
06004DIP5375.50271.87Neutral amino acid transport .

Methodological Approaches for Studying Mb2008

If Mb2008 is a novel transporter, recommended validation steps include:

  1. Heterologous Expression: Use Pichia pastoris or HEK293 cells for protein production .

  2. Subcellular Localization: Tagging with fluorescent markers (e.g., c-myc) to track organelle-specific activity .

  3. Functional Assays: Measure substrate affinity (KmK_m) via radiolabeled amino acid uptake .

Implications for Drug Development

Transporters like PfCRT (malaria) and TgAAT1 (Toxoplasma) are drug targets due to roles in nutrient acquisition and virulence . If Mb2008 is pathogen-associated, it may offer similar therapeutic potential.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lysE; BQ2027_MB2008; Lysine exporter LysE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB2008
Target Protein Sequence
MNSPLVVGFLACFTLIAAIGAQNAFVLRQGIQREHVLPVVALCTVSDIVLIAAGIAGFGA LIGAHPRALNVVKFGGAAFLIGYGLLAARRAWRPVALIPSGATPVRLAEVLVTCAAFTFL NPHVYLDTVVLLGALANEHSDQRWLFGLGAVTASAVWFATLGFGAGRLRGLFTNPGSWRI LDGLIAVMMVALGISLTVT
Uniprot No.

Target Background

Function

Function: Catalyzes the efflux of L-lysine.

Protein Families
LysE/ArgO transporter (TC 2.A.75) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the recommended initial approaches for characterizing Mb2008?

Initial characterization of putative amino acid transporters like Mb2008 should begin with bioinformatic analysis comparing the protein sequence with known transporters. Similar to approaches used for identifying Toxoplasma gondii amino acid transporters, researchers should interrogate genome databases using known lysosomal or vacuolar amino acid transporters as queries . While sequence homology might be relatively low between amino acid transporters from different organisms, structural prediction tools like AlphaFold2, TOPCONS, and I-TASSER can identify transmembrane domains and predict three-dimensional structures that align with confirmed transporters . Researchers should analyze these structural predictions to identify the characteristic 11 transmembrane domains typically found in amino acid transporters, which provides strong initial evidence for transport function before conducting wet-lab experiments.

How should researchers design preliminary experiments to confirm Mb2008's subcellular localization?

When designing experiments to determine Mb2008's subcellular localization, researchers should employ a systematic approach using both fluorescence microscopy and biochemical fractionation methods. The experimental design should include:

  • Generation of epitope-tagged or fluorescent protein-fused Mb2008 constructs

  • Transfection into appropriate cell models

  • Co-localization with established organelle markers

  • Confirmation via subcellular fractionation and immunoblotting

This between-subjects experimental design allows for manipulation of the independent variable (expression of tagged Mb2008) while measuring the dependent variable (subcellular localization pattern) . Control transfections should include known transporters with established localization patterns to validate the experimental system. Researchers should also consider that localization patterns might differ between cell types or physiological conditions, requiring multiple experimental models for comprehensive characterization.

What experimental controls are essential when studying Mb2008 expression?

Control TypePurposeImplementation
Negative ControlEstablish background signalUntransfected cells or non-specific antibody
Positive ControlValidate detection methodKnown amino acid transporter with similar properties
Loading ControlNormalize expression dataHousekeeping protein (β-actin, GAPDH)
Specificity ControlConfirm antibody specificityPre-absorption with immunizing peptide

How can researchers design experiments to determine the amino acid substrate specificity of Mb2008?

Determining substrate specificity requires sophisticated experimental designs that systematically test transport activity across multiple potential substrates. Based on approaches used for other amino acid transporters, researchers should:

First, establish a heterologous expression system in cells with low endogenous amino acid transport activity. Design experiments with the following structure:

  • Independent variable: Different amino acid substrates (presented individually and in competitive inhibition assays)

  • Dependent variable: Transport activity (measured via radiolabeled substrate uptake or fluorescent substrate analogs)

  • Experimental treatments: Varying substrate concentrations to determine kinetic parameters (Km and Vmax)

Analysis should include determination of transport kinetics and inhibition constants, presented in clear tabular format showing the relationship between the independent variables (substrate types/concentrations) and the dependent variable (transport activity) . Statistical significance should be clearly indicated using appropriate methods like ANOVA with post-hoc tests.

What approaches should be used to investigate the role of Mb2008 in cellular survival and differentiation?

Investigation of Mb2008's physiological role requires carefully designed gene manipulation experiments. Drawing from studies of other transporters like TgAAT1, researchers should employ genetic approaches such as conditional knockdown or knockout systems to assess functional consequences .

A comprehensive experimental design should include:

  • Generation of cell lines with inducible knockdown/knockout of Mb2008

  • Assessment of cellular phenotypes under normal and stress conditions

  • Complementation studies with wildtype and mutant versions of Mb2008

  • Measurement of multiple dependent variables including:

    • Cell viability and growth rates

    • Differentiation markers

    • Metabolic profiles

    • Amino acid uptake and utilization

Researchers should be careful to distinguish between direct effects of Mb2008 loss and compensatory mechanisms that might mask phenotypes. Time-course experiments are particularly valuable, as phenotypes may emerge only under specific conditions or timepoints . Statistical analysis must account for potential confounding variables and include appropriate controls for genetic manipulation techniques used.

How can researchers address contradictions in Mb2008 functional data across different experimental systems?

When faced with contradictory results about Mb2008 function from different experimental approaches, researchers should apply a structured methodology for analyzing these contradictions. Following the framework proposed for handling contradictions in health datasets, researchers should:

  • Identify the interdependent experimental variables (α) involved in the contradiction

  • Enumerate the specific contradictory dependencies (β) defined by domain experts

  • Determine the minimal number of Boolean rules (θ) required to assess these contradictions

This systematic approach allows researchers to classify contradiction patterns (e.g., as an (α,β,θ) tuple) and identify potential sources of discrepancy. For instance, contradictions might arise from differences in:

  • Cell type-specific protein interactions

  • Post-translational modifications affecting function

  • Environmental conditions altering transporter activity

  • Methodological limitations of specific assays

When reporting contradictory findings, researchers should present a comprehensive table showing the specific conditions under which different results were obtained, allowing readers to evaluate potential explanations for the contradictions . This structured analysis helps handle the complexity of multidimensional interdependencies within experimental datasets and guides the design of disambiguating experiments.

What statistical approaches are most appropriate for analyzing Mb2008 transport kinetics data?

When analyzing Mb2008 transport kinetics, researchers should employ both descriptive and inferential statistics appropriate for continuous data. For enzyme-like kinetic analyses:

  • First present descriptive statistics in tabular format, including means, standard deviations, and sample sizes for key parameters (Km, Vmax) under different conditions

  • For comparing kinetic parameters across conditions, appropriate inferential tests include:

    • Student's t-test (for two conditions)

    • ANOVA with post-hoc tests (for multiple conditions)

    • Non-linear regression analysis (for fitting kinetic models)

  • Present results visually using:

    • Michaelis-Menten plots

    • Lineweaver-Burk or Eadie-Hofstee transformations

    • Inhibition curves with calculated IC50 values

The independent variable (typically substrate concentration) should be presented in table columns, while dependent variable attributes (transport rates) are presented in rows, allowing readers to easily scan how transport values change as substrate concentrations vary . Report confidence intervals for all kinetic parameters to demonstrate the reliability of the estimates and clearly indicate which results reached statistical significance.

How should researchers interpret localization data that differs between imaging and biochemical approaches?

When faced with discrepancies between imaging and biochemical fractionation data regarding Mb2008 localization, researchers should implement a systematic approach to resolve these contradictions:

  • Consider the different sensitivity and resolution limitations of each method:

    • Imaging provides spatial information but may have limited resolution

    • Biochemical fractionation may disrupt native membrane associations

  • Apply a contradiction pattern analysis following the (α,β,θ) notation to structure the investigation:

    • Identify the specific interdependent data items (methods and markers used)

    • Define the contradictory dependencies (specific localization patterns)

    • Determine the minimum number of Boolean rules needed to explain the contradictions

  • Design validation experiments using complementary approaches:

    • Super-resolution microscopy to improve spatial resolution

    • Immuno-electron microscopy for ultrastructural localization

    • Alternative biochemical approaches (e.g., proximity labeling)

    • Use of multiple organelle markers to resolve partial co-localization

Present the data in a comprehensive table showing organelle marker co-localization coefficients from imaging alongside the biochemical fractionation results, clearly indicating areas of agreement and disagreement. This structured approach helps researchers navigate the complexity of subcellular localization data and identify the most likely biological explanation for the observed results .

What approaches should be used when seeking expert advice on challenging aspects of Mb2008 research?

When facing technical or interpretive challenges in Mb2008 research, seeking expert advice strategically can significantly improve research outcomes. Studies on advice-seeking behavior indicate that, contrary to common concerns, seeking advice on difficult tasks actually increases rather than decreases perceptions of competence .

Researchers should:

  • Identify specific areas where expert input would be most valuable (e.g., structural modeling, transport assay optimization, or statistical analysis)

  • Approach advisors who are known to be accurate, trustworthy, and accessible in their specific domain of expertise

  • Frame questions precisely, demonstrating your existing knowledge while clearly identifying the specific gap or challenge

  • Consider seeking advice from multiple sources for particularly complex issues, as integrating diverse perspectives often leads to more robust solutions

When implementing advice, researchers should document how the suggested approaches were incorporated and how they affected experimental outcomes. This creates a valuable record for future work and appropriately acknowledges the intellectual contributions of advisors .

What experimental design considerations are important when comparing Mb2008 with other amino acid transporters?

When designing comparative studies between Mb2008 and other amino acid transporters, researchers should implement a carefully structured experimental approach that controls for technical and biological variables. The experimental design should:

  • Express multiple transporters under identical conditions to minimize experimental artifacts:

    • Use the same expression system and vector backbone

    • Normalize for expression levels using quantitative methods

    • Include epitope tags in consistent positions

  • Implement a factorial design examining multiple independent variables:

    • Substrate types and concentrations

    • Environmental conditions (pH, temperature, ion composition)

    • Inhibitor profiles

    • Post-translational modifications

  • Employ both between-subjects designs (different transporters in separate experiments) and within-subjects designs (multiple transporters tested in parallel) as appropriate

  • Include appropriate controls:

    • Empty vector controls

    • Known transporters with well-characterized properties

    • Multiple cell types to identify cell-specific effects

When analyzing results, create comprehensive comparison tables showing transport parameters across different transporters, with statistical analyses clearly indicating significant differences. This approach allows researchers to identify unique features of Mb2008 while contextualizing its function within the broader amino acid transporter family.

How can researchers effectively design studies to investigate the structure-function relationship of Mb2008?

Investigating structure-function relationships in Mb2008 requires a methodical approach combining computational prediction with experimental validation. Researchers should:

  • Begin with computational structural analysis:

    • Generate 3D structural models using AlphaFold2, I-TASSER, or similar tools

    • Identify conserved domains, particularly the predicted 11 transmembrane domains typical of amino acid transporters

    • Use structural alignment with known transporters to predict functional residues

  • Design a systematic mutagenesis strategy:

    • Target predicted substrate binding sites

    • Modify potential gating residues

    • Alter conserved motifs in transmembrane domains

    • Create chimeric transporters with related proteins

  • Implement functional assays to evaluate mutant phenotypes:

    • Transport kinetics (Km, Vmax changes)

    • Substrate specificity alterations

    • Cellular localization effects

    • Protein stability and folding impacts

Present results in a comprehensive table correlating specific structural elements with functional changes, including statistical measures of significance. This systematic approach allows researchers to map the functional architecture of Mb2008 and gain insights into the molecular mechanisms of substrate recognition and transport.

What methodological approaches are most effective for studying post-translational regulation of Mb2008?

Studying post-translational regulation of Mb2008 requires a multi-faceted approach that integrates proteomic analysis with functional studies. Researchers should design experiments that:

  • Identify potential post-translational modifications (PTMs):

    • Mass spectrometry analysis of purified Mb2008

    • Phosphoproteomic analysis under various conditions

    • Use of PTM-specific antibodies

    • Bioinformatic prediction of modification sites

  • Create a systematic experimental design to test modification effects:

    • Site-directed mutagenesis of modification sites

    • Pharmacological inhibition of modifying enzymes

    • Manipulation of signaling pathways that regulate modifications

    • Creation of phosphomimetic and phosphodeficient mutants

  • Measure functional consequences across multiple parameters:

    • Transport activity

    • Protein localization

    • Protein-protein interactions

    • Protein stability and turnover

  • Design time-course experiments to capture dynamic regulation:

    • Responses to nutrient availability

    • Stress conditions

    • Cell cycle progression

    • Differentiation signals

Present results in tables showing relationships between specific modifications and functional parameters, including statistical analyses to identify significant regulatory events. This comprehensive approach allows researchers to understand how Mb2008 activity is dynamically regulated in response to cellular needs and environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.