Recombinant Putative amino-acid transporter Rv0488/MT0507 (Rv0488, MT0507)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Recombinant Rv0488/MT0507 is commercially available in three primary variants:

VariantHost SystemTagPurityApplications
Full-length (1-201aa)E. coliHis-tag≥90%Structural studies, assays
Partial sequence (Unspecified)Cell-free expressionNone≥85%Functional assays
Partial sequence (Unspecified)Mammalian cellsVariable≥85%Antibody production
  • Purification: Achieved via affinity chromatography (e.g., Ni-NTA for His-tagged versions) .

  • Reconstitution: Recommended in Tris/PBS-based buffers with 6% trehalose or glycerol for stability .

Research Applications

  • Antibody development: Used as an antigen to generate antibodies for TB diagnostic kits .

  • Structural biology: Crystallization studies to resolve membrane topology and ligand-binding sites .

  • Pathogenesis studies: Investigating its role in M. tuberculosis survival under nutrient-limited conditions .

Limitations and Future Directions

  • Functional ambiguity: The transporter’s exact substrates and regulatory mechanisms require validation via radiolabeled uptake assays or CRISPR knockout models.

  • Therapeutic exploration: Potential for inhibitor development against TB by blocking amino acid uptake pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Target Names
Rv0488, MT0507
Target Protein Sequence
MMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGALIAAGVGGFAALIHAHPNMTLV ARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALIGVVQMCLVVTFLNPHVYLDTVVL IGALANEESDLRWFFGAGAWAASVVWFAVLGFSAGRLQPFFATPAAWRILDALVAVTMIG VAVVVLVTSPSVPTANVALII
Uniprot No.

Q&A

What is the Rv0488/MT0507 protein and what organism does it originate from?

Rv0488/MT0507 is a putative amino-acid transporter protein encoded by the genome of Mycobacterium tuberculosis (MTB), the causative agent of tuberculosis. The protein consists of 201 amino acids and is classified as a membrane transporter involved in amino acid transport across cellular membranes . As a putative amino acid transporter, it may play a role in the uptake of amino acids required for bacterial growth and survival. The designation "Rv0488" refers to the gene locus in the H37Rv reference strain of M. tuberculosis, while "MT0507" refers to the corresponding locus in a different strain annotation system.

How is the recombinant Rv0488/MT0507 protein typically produced for research purposes?

The recombinant form of Rv0488/MT0507 is commonly produced in Escherichia coli expression systems. According to available specifications, it can be produced as a full-length recombinant protein (spanning all 201 amino acid residues) with a histidine tag to facilitate purification . The His-tagged version enables researchers to employ affinity chromatography techniques for efficient isolation of the protein from bacterial lysates. This approach is similar to methods used for other membrane transporters from mycobacterial species, where codon optimization may also be employed to enhance expression in the E. coli host system.

What analytical techniques are most effective for characterizing the structure and function of Rv0488/MT0507?

For structural characterization of Rv0488/MT0507, multiple complementary approaches should be employed. X-ray crystallography and cryo-electron microscopy are gold standard techniques for determining the three-dimensional structure, though membrane proteins present significant challenges for crystallization. Circular dichroism spectroscopy can provide insights into secondary structure elements, while nuclear magnetic resonance (NMR) may help characterize dynamic regions. Similar to approaches used for other mycobacterial membrane proteins, homology modeling techniques can be utilized to predict structure .

For functional characterization, transport assays using isotope-labeled amino acids or fluorescent amino acid analogs can determine substrate specificity and kinetic parameters. Site-directed mutagenesis of conserved residues followed by functional assays can identify key amino acids involved in substrate binding and transport. Reconstitution of the purified protein into liposomes or nanodiscs allows for controlled assessment of transport activity in a membrane environment.

How does the amino acid composition of Rv0488/MT0507 influence its expression and stability in recombinant systems?

The amino acid composition of Rv0488/MT0507 presents several challenges for recombinant expression. As a membrane protein with hydrophobic domains, it requires careful optimization of expression systems. Studies on recombinant protein production indicate that the amino acid composition directly impacts protein folding kinetics and stability . For membrane transporters like Rv0488/MT0507, the presence of multiple transmembrane regions necessitates specialized expression strategies.

When expressing Rv0488/MT0507, researchers should consider:

  • Codon optimization for the expression host (typically E. coli)

  • Use of specialized E. coli strains that provide rare tRNAs

  • Membrane-targeted expression systems

  • Temperature modulation during expression (often lower temperatures improve proper folding)

  • Addition of specific chaperones to assist folding

The hydrophobic nature of membrane domains may require detergent solubilization strategies during purification. The cysteine content is particularly important to monitor, as improper disulfide bond formation can lead to aggregation and loss of functional protein .

What metabolic modeling approaches can be applied to understand the role of Rv0488/MT0507 in Mycobacterium tuberculosis physiology?

Metabolic modeling of Rv0488/MT0507 function can provide insights into its role in M. tuberculosis physiology. Flux Balance Analysis (FBA) approaches, similar to those used for CHO cells, can be adapted to mycobacterial metabolism . To implement this for Rv0488/MT0507:

  • Incorporate the transporter into genome-scale metabolic models of M. tuberculosis

  • Constrain the model with experimentally determined amino acid uptake rates

  • Perform in silico knockout simulations to predict the impact of Rv0488/MT0507 deletion

  • Model alternative nutrient conditions to assess conditional essentiality

  • Integrate transcriptomic data to refine model predictions under different growth conditions

A comprehensive modeling approach should include:

Modeling ComponentImplementation for Rv0488/MT0507Expected Outcome
Reaction stoichiometryDefine amino acid transport reactionsQuantitative flux predictions
Biomass functionInclude protein in biomass equationGrowth dependence assessment
Transport constraintsSet upper/lower bounds for transportPhysiological limitations
Gene-protein-reaction rulesLink gene to transporter functionGenetic manipulation predictions
Sensitivity analysisVary transport parametersIdentify critical conditions

These approaches parallel the genome-scale metabolic modeling techniques described for CHO cells, where constraining specific uptake reactions provides insight into cellular metabolism .

How can structural bioinformatics approaches be applied to identify potential inhibitors of Rv0488/MT0507?

Structural bioinformatics approaches provide powerful tools for identifying potential inhibitors of Rv0488/MT0507, particularly given the challenges of experimental structure determination for membrane proteins. A comprehensive approach would involve:

  • Homology modeling using related transporters as templates, similar to approaches used for Rv0986

  • Molecular dynamics simulations to refine models and identify conformational states

  • Binding site prediction using computational algorithms

  • Virtual screening of compound libraries against predicted binding sites

  • Molecular docking to evaluate binding poses and affinities

The quality assessment of structural models should employ multiple validation methods:

  • Ramachandran plot analysis through PROCHECK

  • Verify3D for residue environment assessment

  • Z-score evaluation with ProSA-web

  • QMEAN scoring from Swiss-Model

Once high-quality structural models are developed, molecular docking can be performed with potential inhibitors. Compounds targeting transporters similar to Rv0488/MT0507 can serve as starting points for structure-based drug design efforts.

What is the optimal experimental design for assessing the substrate specificity of Rv0488/MT0507?

To comprehensively assess the substrate specificity of Rv0488/MT0507, a systematic experimental design combining multiple approaches is recommended:

  • Expression system optimization: Expression in E. coli with His-tagging for purification, potentially exploring multiple constructs with varying tag positions .

  • Reconstitution approaches:

    • Proteoliposome reconstitution for direct transport assays

    • Nanodiscs for structural and binding studies

    • Whole-cell uptake assays in modified E. coli with native transporters deleted

  • Substrate panel: Test a comprehensive panel of amino acids and derivatives:

Substrate CategoryExamplesDetection Method
Essential amino acidsLeu, Ile, Val, Met, Phe, Trp, His, Lys, ThrRadiolabeled isotopes
Non-essential amino acidsAla, Ser, Cys, Gly, Tyr, Pro, Glu, Gln, Asp, AsnRadiolabeled isotopes
D-amino acidsD-Ser, D-AlaEnzymatic coupled assays
Amino acid analogsFluorescent derivativesFluorescence detection
  • Kinetic characterization: Determine:

    • Transport rates (Vmax)

    • Substrate affinity (Km)

    • Inhibition constants (Ki) for competitive substrates

    • Energy dependence of transport

  • Competition assays: Perform cross-competition studies between identified substrates to map binding site interactions.

This approach integrates methodologies from studies of other transporters and applies them specifically to Rv0488/MT0507, providing comprehensive substrate specificity data .

How can genomic knockout and complementation studies be designed to validate the function of Rv0488/MT0507 in vivo?

To validate the function of Rv0488/MT0507 in vivo, a comprehensive genetic approach combining knockout and complementation studies should be employed:

  • Knockout strategy:

    • Use specialized transduction with temperature-sensitive mycobacteriophages to deliver knockout constructs

    • Employ CRISPR-Cas9 systems adapted for mycobacteria

    • Confirm gene deletion by PCR and sequencing

    • Verify protein absence by Western blotting

  • Phenotypic characterization of knockout strains:

    • Growth curves in defined media with different amino acid compositions

    • Metabolomic profiling to identify accumulated or depleted metabolites

    • Transcriptomic analysis to identify compensatory responses

    • In vitro stress resistance (acid, oxidative, nutrient limitation)

    • Macrophage infection models to assess intracellular survival

  • Complementation studies:

    • Reintroduce wild-type Rv0488/MT0507 under native or inducible promoters

    • Create point mutations in conserved residues to identify essential amino acids

    • Test heterologous complementation with related transporters

    • Perform domain swapping experiments to identify functional regions

  • In vivo assessment:

    • Mouse infection models to evaluate virulence

    • Competitive index assays comparing wild-type and mutant strains

    • Histopathological examination of infected tissues

    • Bacterial burden quantification in different organs

This systematic approach will provide definitive evidence for the physiological role of Rv0488/MT0507 and its importance for M. tuberculosis survival and pathogenesis.

What statistical approaches are most appropriate for analyzing transport kinetics data for Rv0488/MT0507?

Statistical analysis of transport kinetics data for Rv0488/MT0507 requires rigorous approaches to account for the complexities of membrane protein function. Recommended statistical methods include:

  • Nonlinear regression analysis for fitting transport kinetics data to appropriate models:

    • Michaelis-Menten kinetics for simple transport

    • Hill equation for cooperative transport

    • Competitive, non-competitive, or mixed inhibition models for inhibitor studies

  • Experimental design considerations:

    • Use statistical design approaches that allow for statistical analysis and control of experimental parameters

    • Implement factorial designs to assess interaction effects between variables

    • Employ response surface methodology to optimize transport conditions

  • Model selection criteria:

    • Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC) to compare competing kinetic models

    • F-test for nested models to determine if additional parameters significantly improve fit

  • Replication and validation:

    • Technical replicates to assess measurement precision

    • Biological replicates to account for variation between protein preparations

    • Cross-validation approaches to test model robustness

  • Data transformation and normalization:

    • Log transformation for wide-ranging kinetic data

    • Normalization approaches to account for variation in protein expression levels

    • Standardization methods for comparing results across different experimental conditions

These statistical approaches ensure robust analysis of transport data, allowing for confident determination of substrate specificity and kinetic parameters for Rv0488/MT0507.

How can multi-omics approaches be integrated to elucidate the role of Rv0488/MT0507 in Mycobacterium tuberculosis pathogenesis?

An integrative multi-omics approach provides comprehensive insights into the role of Rv0488/MT0507 in M. tuberculosis pathogenesis. Implementation should include:

  • Transcriptomics:

    • RNA-seq analysis comparing wild-type and Rv0488 knockout strains

    • Expression profiling under different nutrient conditions and host-relevant stresses

    • Identification of co-regulated genes to place Rv0488 in regulatory networks

  • Proteomics:

    • Quantitative proteomics to assess changes in protein abundance

    • Membrane proteomics to examine alterations in transporter composition

    • Protein-protein interaction studies using pull-down assays with tagged Rv0488

  • Metabolomics:

    • Targeted metabolomics focusing on amino acid pools

    • Untargeted metabolomics to identify unexpected metabolic perturbations

    • Flux analysis using isotope-labeled amino acids

  • Systems biology integration:

    • Network analysis connecting transcriptomic, proteomic, and metabolomic data

    • Pathway enrichment analysis to identify affected biological processes

    • Constraint-based modeling incorporating omics data as in FBA approaches

  • Host-pathogen interaction studies:

    • Dual RNA-seq of infected macrophages

    • Metabolic profiling during infection

    • Spatial transcriptomics in infected tissues

This integrative approach will place Rv0488/MT0507 function in the broader context of M. tuberculosis physiology and pathogenesis, potentially identifying its role in virulence and persistence.

What considerations are important when designing recombinant Rv0488/MT0507 for structural studies?

Designing recombinant Rv0488/MT0507 for structural studies requires careful optimization to overcome the challenges inherent to membrane proteins:

  • Construct design considerations:

    • Multiple constructs with varying N- and C-terminal boundaries

    • Fusion partners to enhance stability and crystallization (T4 lysozyme, BRIL, etc.)

    • Removal or mutation of flexible regions identified by disorder prediction

    • Introduction of thermostabilizing mutations based on homology models

    • His-tag placement optimization (N-terminal, C-terminal, or cleavable)

  • Expression system selection:

    • E. coli-based systems with specialized strains for membrane proteins

    • Eukaryotic systems like insect cells or yeast for complex proteins

    • Cell-free expression systems for toxic proteins

  • Solubilization and purification strategies:

    • Detergent screening (DDM, LMNG, MNG, etc.)

    • Amphipol or nanodisc reconstitution for maintaining native-like environment

    • Lipid cubic phase methods for crystallization

  • Quality control metrics:

    • Size-exclusion chromatography to assess monodispersity

    • Thermal stability assays to identify optimal buffer conditions

    • Functional assays to confirm activity of purified protein

  • Structural technique-specific considerations:

    • For X-ray crystallography: Surface entropy reduction, antibody fragment co-crystallization

    • For cryo-EM: Particle size enhancement, preferred orientation mitigation

    • For NMR: Selective isotope labeling, deuteration strategies

This comprehensive approach maximizes the likelihood of obtaining high-quality structural data for Rv0488/MT0507, facilitating structure-based drug design and mechanistic studies.

What are the most promising research directions for Rv0488/MT0507 in tuberculosis drug discovery?

The exploration of Rv0488/MT0507 opens several promising avenues for tuberculosis drug discovery:

  • Target validation:

    • Conclusive demonstration of essentiality through conditional knockouts

    • Validation in animal infection models

    • Assessment of requirement during different stages of infection (acute vs. latent)

  • Structure-based drug design:

    • Development of high-resolution structures through experimental or computational methods

    • Virtual screening campaigns targeting identified binding pockets

    • Fragment-based drug discovery approaches

  • Transport inhibitor development:

    • High-throughput screening assays for transport inhibition

    • Repurposing of known transporter inhibitors

    • Rational design of substrate analogs as competitive inhibitors

  • Combination therapies:

    • Synergy testing with existing TB drugs

    • Exploration of metabolic vulnerabilities created by transport inhibition

    • Dual-targeting strategies addressing multiple transporters

  • Resistance mechanisms:

    • Investigation of potential resistance mechanisms

    • Development of inhibitors less prone to resistance

    • Combination strategies to prevent resistance emergence

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.