Recombinant Putative amino-acid transporter Rv1986/MT2040 (Rv1986, MT2040)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Rv1986/MT2040 is commercially produced using diverse expression systems:

ParameterDetails
Expression HostE. coli, yeast, baculovirus, or mammalian cells .
Purity≥85% (verified by SDS-PAGE) .
StorageTris-based buffer with 50% glycerol; store at –20°C or –80°C .
StabilityAvoid repeated freeze-thaw cycles; working aliquots stable at 4°C for 1 week .

Role in Amino Acid Transport

  • Rv1986/MT2040 is annotated as a putative amino acid transporter, though direct substrate specificity data remain limited. Homology with bacterial transporters suggests involvement in neutral/cationic amino acid uptake (e.g., arginine, lysine) .

  • In Mycobacterium bovis BCG, deletion of homologous transporters (e.g., Rv0522) disrupted arginine uptake and compromised survival under nutrient stress, highlighting the metabolic importance of such transporters .

Regulatory Context

  • Amino acid transporters like Rv1986/MT2040 may interface with global nutrient-sensing pathways (e.g., mTORC1 in eukaryotes), though direct mechanistic links in mycobacteria require further study .

Research Applications

  • Antigen Production: Used to generate antibodies for immunological studies .

  • Drug Target Exploration: Potential target for disrupting amino acid homeostasis in M. tuberculosis .

  • Structural Studies: Serves as a model for prokaryotic transporter architecture .

Comparative Analysis with Homologs

FeatureRv1986/MT2040Fungal TransportersHuman PAT1 (SLC36A1)
Transmembrane Domains~9–12 (predicted)12 confirmed in Aspergillus 11 confirmed
Substrate SpecificityPutative cationic/neutral amino acidsBroad (e.g., proline, GABA) H+-coupled small neutral amino acids
Expression HostsE. coli, yeast, mammalian cells Yeast, Xenopus oocytes Mammalian cell lines

Outstanding Research Questions

  1. What are the precise substrates and transport kinetics of Rv1986/MT2040?

  2. How does this transporter contribute to M. tuberculosis virulence or persistence?

  3. Can structural elucidation inform inhibitor design for tuberculosis therapy?

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Target Names
Rv1986, MT2040
Target Protein Sequence
MNSPLVVGFLACFTLIAAIGAQNAFVLRQGIQREHVLPVVALCTVSDIVLIAAGIAGFGA LIGAHPRALNVVKFGGAAFLIGYGLLAARRAWRPVALIPSGATPVRLAEVLVTCAAFTFL NPHVYLDTVVLLGALANEHSDQRWLFGLGAVTASAVWFATLGFGAGRLRGLFTNPGSWRI LDGLIAVMMVALGISLTVT
Uniprot No.

Q&A

What is Rv1986/MT2040 and what is its role in Mycobacterium tuberculosis?

Rv1986 (MT2040) is a protein from Mycobacterium tuberculosis that functions as a putative amino acid transporter. Research has demonstrated that Rv1986 plays a significant role in stimulating both humoral and cell-mediated immune responses during tuberculosis infection. This protein has been shown to induce the production of several cytokines, including IL-6, IL-17A, TNF-α, and IFN-γ, suggesting its importance in host-pathogen interactions and potential utility in vaccine development .

What are the optimal methods for recombinant Rv1986 expression and purification?

Recombinant Rv1986 can be successfully produced using PCR amplification from M. tuberculosis H37Rv genomic DNA with specifically designed primers. For optimal expression, the gene should be cloned with a C-terminal His-tag (6 histidine residues) to facilitate purification. Based on published protocols, the recommended approach involves:

  • PCR amplification using forward primer (5'-AAG GAA TTC CAT CCA GTG GCG ATT CTG C-3') and reverse primer (5'-CGC CCA AGC TTT GGT GAT CGG ATT CCC GTA G-3')

  • Expression in suitable E. coli strains

  • Purification via affinity chromatography using the His-tag

  • Confirmation of purity through SDS-PAGE and Western blotting

This methodology yields soluble recombinant protein suitable for immunological studies.

What specific immune responses does Rv1986 stimulate?

Rv1986 demonstrates impressive immunostimulatory properties that make it relevant for tuberculosis research. In experimental models, Rv1986 has been shown to:

  • Stimulate significant IFN-γ production, a key cytokine in cell-mediated immunity against tuberculosis

  • Induce production of IL-6, IL-17A, and TNF-α, important inflammatory cytokines

  • Increase IL-2 levels, associated with central memory T cell activation

  • Promote expansion of B cells and plasma cells, supporting humoral immunity

  • Enhance memory T cell proliferation, critical for long-term protection

These properties collectively suggest Rv1986's potential role in protective immunity against M. tuberculosis infection.

How effective is Rv1986 as a diagnostic antigen for tuberculosis detection?

While Rv1986 induces antibody responses in tuberculosis patients, its standalone diagnostic value shows limitations. According to ELISA test results comparing Rv1986 with standard tuberculin (PPD) tests:

These results indicate that while Rv1986 has potential as a diagnostic antigen, it may be more valuable when combined with other M. tuberculosis antigens to improve sensitivity. The relatively high specificity suggests it could help reduce false positives in multi-antigen diagnostic panels.

ELISA MethodPositive NumbersDetection Rate
Rv19862424%
Total100100%

What are the recommended dosages and administration routes for Rv1986 in animal models?

For immunization studies in murine models, researchers have successfully employed the following protocol:

  • Dosage: 60 μg recombinant Rv1986 per mouse per injection

  • Adjuvant: Incomplete Freund's adjuvant (50% v/v, total volume)

  • For combination studies: 30 μg Rv1986 plus 30 μg of another antigen (e.g., Rv3823c)

  • Administration route: Intraperitoneal injection

  • Schedule: Multiple injections with appropriate intervals (typically 2-3 weeks apart)

This protocol has demonstrated effectiveness in stimulating measurable immune responses in mice, making it a reliable starting point for new investigations.

How should researchers design experiments to assess Rv1986's stimulation of cellular immunity?

A comprehensive experimental design for evaluating Rv1986's effects on cellular immunity should include:

  • Control groups: PBS-only, adjuvant-only, and irrelevant protein controls

  • Cytokine profiling: Measurement of key cytokines including IFN-γ, IL-2, IL-6, IL-17A, and TNF-α via ELISA or multiplex assays

  • Cell population analysis: Flow cytometry to quantify:

    • Memory T cell subsets (CD4+/CD8+ central and effector memory)

    • B cell and plasma cell populations (CD19+ CD45R+ CD138- for B cells)

    • Dendritic cells and other antigen-presenting cells

  • Functional assays: Lymphocyte proliferation assays in response to antigen restimulation

  • Challenge studies: For vaccine potential, include M. tuberculosis challenge to assess protection

This approach provides a comprehensive assessment of both the type and magnitude of cellular responses induced by Rv1986.

What synergistic effects are observed when combining Rv1986 with Rv3823c?

Research demonstrates interesting synergistic and differential effects when Rv1986 is combined with Rv3823c:

  • The combination induces significant IFN-γ production, similar to Rv1986 alone, suggesting Rv1986 is the primary driver of this response

  • Both proteins together stimulate IL-2 production significantly compared to control groups

  • The combination enhances pro-inflammatory cytokine IL-17A production more than either protein alone

  • TNF-α production is stimulated by both proteins, with Rv1986 showing stronger effects

  • Interestingly, the plasma cell expansion induced by Rv1986 plus adjuvant was greater than that induced by the Rv1986-Rv3823c-adjuvant combination

These findings suggest potential combinatorial approaches for vaccine development, where different antigens could be selected to achieve specific immune response profiles.

How does Rv1986 compare with other M. tuberculosis antigens for immune stimulation?

Rv1986 exhibits unique immunostimulatory properties compared to other M. tuberculosis antigens:

  • Stronger IFN-γ induction than many other M. tuberculosis antigens, including Rv3823c

  • Ability to stimulate both humoral and cell-mediated immunity, unlike some antigens that primarily elicit one type of response

  • Capacity to induce central memory T cells and IL-2 production, which is not universal among tuberculosis antigens

  • Comparable but distinct cytokine profiles compared to other immunogenic proteins

The ability to induce IFN-γ is particularly significant, as this cytokine is critical in anti-tuberculosis cell-mediated immune responses, marking Rv1986 as potentially valuable in vaccine formulations.

What is Rv1986's potential in tuberculosis vaccine development?

Rv1986 shows several characteristics that make it a promising candidate for tuberculosis vaccine development:

  • Balanced immune response: Stimulates both humoral (antibody-mediated) and cell-mediated immunity

  • Th1 polarization: Induces IFN-γ and IL-2, critical for protective immunity against intracellular pathogens

  • Memory T cell induction: Promotes development of central memory T cells, essential for long-term protection

  • Pro-inflammatory profile: Stimulates IL-6, IL-17A, and TNF-α, creating an appropriate inflammatory environment

  • Complementary effects: Works synergistically with other antigens like Rv3823c

How might genetic variations in Rv1986 affect immunogenicity across different M. tuberculosis strains?

While the search results don't directly address genetic variations in Rv1986, this represents an important research question. Researchers should consider:

  • Comparative genomic analysis of Rv1986 sequences across clinical and laboratory M. tuberculosis strains

  • Identification of conserved epitopes vs. variable regions that might affect immune recognition

  • Testing recombinant proteins representing major variants to assess differential immune stimulation

  • Evaluating whether strain-specific variations correlate with clinical outcomes or geographical distribution

Such studies would help determine whether Rv1986-based diagnostics or vaccines would be broadly effective or would require strain-specific adaptations.

What are common challenges in working with recombinant Rv1986 and how can they be addressed?

Researchers working with Rv1986 should anticipate several technical challenges:

  • Protein solubility issues: Some M. tuberculosis proteins can form inclusion bodies when expressed in E. coli. Consider:

    • Optimizing expression temperature (often lower temperatures improve solubility)

    • Using solubility-enhancing fusion tags (MBP, SUMO, etc.)

    • Exploring alternative expression hosts like yeast systems

  • Purification challenges: His-tagged proteins may co-purify with bacterial contaminants. Implement:

    • Multi-step purification protocols combining affinity chromatography with size exclusion or ion exchange

    • Endotoxin removal steps for immunological applications

    • Western blot verification of purity using anti-His and anti-Rv1986 antibodies

  • Activity preservation: Ensure the recombinant protein retains its native conformation by:

    • Validating activity through functional assays

    • Using circular dichroism or other structural analyses to confirm proper folding

    • Testing different buffer conditions for optimal stability

How can false-negative and false-positive rates be reduced when using Rv1986 in tuberculosis diagnostics?

The reported false-negative (57.9%) and false-positive (16.7%) rates for Rv1986-based ELISA indicate significant limitations for standalone diagnostic use. To improve diagnostic accuracy:

  • Combine multiple antigens: Develop a multi-antigen panel including Rv1986 alongside other M. tuberculosis-specific proteins

  • Optimize cutoff values: Systematically evaluate different cutoff thresholds to balance sensitivity and specificity

  • Improve assay conditions: Optimize blocking agents, sample dilutions, and detection systems

  • Population-specific validation: Account for geographical differences in M. tuberculosis strains and host genetics

  • Complement with other tests: Use in conjunction with established methods like interferon-gamma release assays (IGRAs) or microscopy

This multi-faceted approach can potentially leverage Rv1986's high specificity while addressing its sensitivity limitations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.