Recombinant Putative anionic 4-hydroxy-benzoate permease

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

Recombinant Putative Anionic 4-Hydroxy-Benzoate Permease is a transmembrane protein engineered for enhanced study of aromatic compound transport mechanisms. Originating from Thauera aromatica, this protein is hypothesized to facilitate the uptake of 4-hydroxy-benzoate (4-HB), a key intermediate in anaerobic degradation pathways of aromatic pollutants . Produced recombinantly in Escherichia coli, it is tagged with a polyhistidine (His) sequence for purification and detection . Its role in microbial metabolism aligns with broader research on biodegradation of environmental contaminants, particularly lignin-derived monomers and industrial pollutants .

Primary Structure

  • Amino Acid Sequence: Comprises 164 residues (UniProt ID: O33821), with the N-terminal His tag facilitating affinity chromatography .

  • Sequence Motifs: Contains conserved regions typical of ABC transporters, including transmembrane helices and substrate-binding domains .

Physicochemical Properties

PropertyValueSource
Molecular Weight~19 kDa (theoretical)
Isoelectric Point (pI)8.5 (predicted)
Purity>90% (SDS-PAGE verified)

Substrate Specificity

The permease selectively transports 4-hydroxy-benzoate, an anion critical for microbial aromatic degradation . Kinetic studies suggest a high affinity for 4-HB, though direct binding assays remain pending .

Proposed Role in Metabolic Pathways

  • Anaerobic Biodegradation: Likely participates in the uptake of 4-HB for subsequent conversion to benzoyl-CoA, a central intermediate in anaerobic pathways .

  • Synergy with Degradation Enzymes: Co-expressed with enzymes like benzoyl-CoA reductase in Rhodopseudomonas palustris, hinting at conserved regulatory mechanisms .

Key Applications

  • Transport Studies: Used in in vitro assays to elucidate substrate specificity and energy coupling mechanisms .

  • Bioremediation: Investigated for enhancing microbial uptake of aromatic pollutants in contaminated environments .

  • Structural Biology: Serves as a model for crystallography and cryo-EM studies of anion transporters .

Experimental Findings

Study FocusKey ResultReference
Heterologous ExpressionFunctional in E. coli BL21
Substrate LocalizationMembrane-associated activity

Expression System

  • Host: E. coli (BL21 or similar strains) .

  • Vector: Plasmid-based systems with inducible promoters (e.g., T7/lac) .

Purification Workflow

  1. Lysis: Sonication in Tris/PBS buffer (pH 8.0).

  2. Affinity Chromatography: Ni-NTA resin for His-tag binding .

  3. Buffer Exchange: Stabilized in 6% trehalose for lyophilization .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
Putative anionic 4-hydroxy-benzoate permease; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Thauera aromatica
Target Protein Sequence
CGRRRGSLAWPDASSPSANPRPGAGAAESSACTTSGWSRWRTSLLVAGALLGLQWLPQLA GLWVACFGFGTGACIILALMFMGLRTENPRQAAALSGMAQCVGYLLAAFGPPLVGGLRDR SQDWNPALTVCLVLSLTMAAAGMLAGRNRRIRSASTAASTPAAG
Uniprot No.

Target Background

Function
Putative involvement in the uptake of anionic 4-hydroxy-benzoate.
Protein Families
Major facilitator superfamily, Cyanate porter (TC 2.A.1.17) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does recombinant expression impact structural and functional studies of this permease?

Recombinant expression provides several methodological advantages for studying membrane proteins like the putative anionic 4-hydroxy-benzoate permease. The specific recombinant version described in the literature features an N-terminal His tag expressed in E. coli , offering the following research benefits:

  • Purification efficiency: The His tag enables single-step affinity purification using metal chelation chromatography, yielding protein with >90% purity as determined by SDS-PAGE .

  • Controlled experimental conditions: Researchers can precisely manipulate expression conditions to optimize protein yield and solubility.

  • Structural investigations: Purified protein can be used for crystallography, cryo-EM, or NMR studies to determine three-dimensional structure.

  • Functional reconstitution: The permease can be incorporated into artificial membrane systems for transport assays without interference from other cellular components.

  • Membrane protein folding: E. coli expression systems may not always produce correctly folded membrane proteins, potentially requiring optimization of expression conditions.

  • Post-translational modifications: The bacterial expression system may not reproduce modifications present in the native host.

  • Detergent selection: The choice of detergent for solubilization significantly impacts protein stability and activity.

What experimental evidence demonstrates the transport function of this permease?

While direct experimental evidence for this specific permease is limited in the provided literature, studies of homologous proteins like BenK from Acinetobacter sp. strain ADP1 provide a methodological framework for functional characterization :

  • Genetic evidence: Disruption of the benK gene reduced benzoate uptake and impaired the growth of Acinetobacter on benzoate or benzaldehyde as the sole carbon source .

  • pH-dependent transport: BenK-dependent transport becomes more critical at higher pH values where passive diffusion of the undissociated acid is limited. In wild-type strains, growth rates were consistent across pH values (6.5-8.1), suggesting active transport, while in BenK-deficient strains, growth rates decreased at higher pH .

  • Substrate specificity: The BenK permease specifically affected growth on benzoate and benzaldehyde but not on 4-hydroxybenzoate, indicating substrate selectivity .

Similar experimental approaches could be applied to confirm the function of the putative anionic 4-hydroxy-benzoate permease, including genetic knockout studies, pH-dependent growth assays, and direct transport measurements with radiolabeled substrates.

What are the optimal conditions for recombinant expression and purification of this permease?

Based on the product information and general principles for membrane protein purification, the following conditions are recommended for optimal handling of recombinant putative anionic 4-hydroxy-benzoate permease:

Expression System Parameters:

ParameterRecommended ConditionNotes
Expression HostE. coliStrain optimization may improve yield
Fusion TagN-terminal His tagFacilitates purification via IMAC
MediumRich medium (e.g., LB)Supplementation with trace elements may improve yield
InductionIPTG (concentration strain-dependent)Lower temperatures (16-20°C) often improve membrane protein folding

Purification and Storage Conditions:

ParameterRecommended ConditionNotes
SolubilizationDetergent screening recommendedDDM, LMNG, or digitonin are often effective
Buffer SystemTris/PBS-based buffer, pH 8.0 with 6% TrehaloseFor stability during storage
Storage FormLyophilized powderReconstitution required before use
Reconstitution0.1-1.0 mg/mL in deionized sterile waterAddition of 5-50% glycerol recommended for storage
Storage Temperature-20°C/-80°C for long-termWorking aliquots can be stored at 4°C for up to one week
Stability ConsiderationAvoid repeated freeze-thaw cyclesAliquoting is necessary for multiple use

How do pH conditions affect permease-mediated transport of aromatic compounds?

pH plays a critical role in permease-mediated transport of aromatic compounds, as demonstrated in studies of benzoate transport:

  • Chemical principles: Aromatic acids like benzoate exist in equilibrium between protonated (uncharged) and deprotonated (anionic) forms. At lower pH, the protonated form predominates and can diffuse passively across membranes, while at higher pH, the anionic form requires active transport .

  • Experimental evidence: The BenK study demonstrated pH-dependent growth patterns. Wild-type Acinetobacter strain ADP1 grew consistently on benzoate across pH values from 6.5 to 8.1, while the BenK-deficient strain ACN71 showed progressively slower growth as pH increased . This indicates that:

    a. At low pH: Passive diffusion of protonated benzoate is sufficient for growth
    b. At high pH: Active transport via permeases becomes essential

  • Quantitative impact: The study demonstrated that at pH 8.1, the benK-deficient strain had significantly longer generation times compared to wild-type when grown on benzoate, but showed no difference when grown on benzaldehyde or 4-hydroxybenzoate .

For research on anionic 4-hydroxy-benzoate permease, similar pH-dependent studies would be valuable to determine:

  • The pKa of 4-hydroxy-benzoate (which affects the protonated/deprotonated ratio)

  • The pH range where active transport via the permease becomes dominant

  • Potential coupling of transport to proton or sodium gradients

What molecular techniques are used to study gene regulation of permease expression?

Research on similar bacterial transport systems provides a methodological framework for studying permease gene regulation:

  • Transcriptional analysis methods:

    • Real-time PCR: Used to quantify mRNA expression levels of permease genes in response to substrates or environmental conditions

    • Northern blotting: For detection of specific transcripts and operon structure analysis

    • Reporter gene fusions: Construction of permease promoter-reporter fusions (e.g., lacZ, gfp) to measure promoter activity

  • Genomic analysis approaches:

    • Bioinformatic analysis of promoter regions to identify potential regulatory elements

    • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding sites

    • DNA footprinting to determine precise protein-DNA interactions

  • Global regulation studies:

    • Transcriptomics using microarrays or RNA-seq to identify co-regulated genes

    • Cluster analysis to identify genes with similar expression patterns

The benzoate transcriptome study exemplifies how comprehensive gene expression analysis can reveal regulatory networks. The research demonstrated that 42% of genes up-regulated by benzoate were also up-regulated during growth at external pH 6 compared to pH 7, suggesting a "cytoplasmic pH" transcriptome .

Analysis MethodApplicationKey Information Provided
Microarray AnalysisGlobal transcriptome profilingIdentified 164 genes up-regulated and 102 genes down-regulated by benzoate exposure
Real-time PCRValidation of expression changesConfirmed expression ratios for selected genes of interest
Statistical AnalysisSignificance testingt-tests on log2-transformed data with p<0.001 significance level
Cluster AnalysisIdentification of co-regulated genesHierarchical clustering with uncentered Pearson correlation

What approaches can determine substrate specificity of the permease?

Determining substrate specificity of the putative anionic 4-hydroxy-benzoate permease requires multiple complementary approaches:

  • Genetic approaches:

    • Gene knockout/disruption studies: Compare growth of wild-type and permease-deficient strains on various substrates, as demonstrated in the BenK study

    • Heterologous expression: Express the permease in a host lacking similar transporters to test substrate utilization

  • Biochemical methods:

    • Direct transport assays: Measure uptake of radiolabeled potential substrates

    • Competition assays: Test if non-labeled compounds compete with labeled substrate

    • Binding studies: Determine substrate binding using purified protein

  • Structural and computational methods:

    • Homology modeling based on related transporters with known structures

    • Molecular docking simulations with potential substrates

    • Site-directed mutagenesis of predicted binding site residues

  • Physiological studies:

    • pH-dependent growth assays with different substrates (similar to the approach used for BenK)

    • Measurement of substrate metabolism in permease-expressing versus control cells

For example, the BenK study demonstrated substrate specificity by showing that the permease-deficient strain had reduced growth specifically on benzoate and benzaldehyde, but not on 4-hydroxybenzoate . This approach systematically distinguishes substrates from non-substrates and could be applied to characterize the specificity of the 4-hydroxy-benzoate permease.

How can researchers distinguish between passive diffusion and permease-mediated transport?

Distinguishing between passive diffusion and permease-mediated transport is critical for characterizing membrane transporters. The following methodological approaches can be employed:

  • pH-dependent studies: As demonstrated in the BenK research, comparing growth or transport at different pH values can reveal permease contribution . The researchers showed that at higher pH (8.1), where benzoate exists predominantly in its charged form, the permease-deficient strain grew more slowly than at lower pH (6.5), consistent with reduced passive diffusion of the charged form .

  • Genetic approaches: Comparing wild-type organisms with permease knockout mutants provides direct evidence of permease contribution to transport. Any residual transport in knockout strains can be attributed to passive diffusion or other transporters .

  • Kinetic analysis: Passive diffusion shows linear concentration dependence, while carrier-mediated transport typically shows saturation kinetics following Michaelis-Menten behavior. Researchers can plot transport rates against substrate concentration to distinguish these mechanisms.

  • Temperature dependence: Measure transport at different temperatures to calculate activation energy. Permease-mediated transport typically has higher activation energy than passive diffusion.

  • Inhibitor studies: Specific inhibitors of active transport (e.g., protonophores if the transport is coupled to proton gradients) will affect permease-mediated but not passive transport.

The experimental design used in the BenK study provides an excellent model for distinguishing these mechanisms:

pHWild-type GrowthPermease-deficient GrowthInterpretation
6.5NormalNear normalPassive diffusion sufficient
7.0NormalModerately reducedBoth mechanisms contribute
8.1NormalSignificantly reducedPermease-mediated transport dominant

What is known about the energetics of transport mediated by this class of permeases?

The energetics of transport by anionic 4-hydroxy-benzoate permease and related transporters can be understood through several experimental approaches:

  • Coupling mechanism: Many bacterial permeases couple substrate transport to ion gradients (typically H+ or Na+). The BenK study suggests a potential proton-coupling mechanism, as the transport becomes more important at higher pH where the proton gradient may be leveraged for active transport .

  • pH effects on cytoplasmic acidification: Studies on benzoate transport in B. subtilis showed that benzoate caused cytoplasmic acidification, with the extent depending on concentration . At pH 7, adding 30 mM benzoate lowered cytoplasmic pH by 0.3 units, while 60 mM benzoate lowered it by 0.4 units .

  • Transmembrane pH gradient (ΔpH): The benzoate study measured a residual ΔpH of 0.25 units even at high benzoate concentrations (60 mM), suggesting active mechanisms maintaining the proton gradient despite the challenge of permeant acid .

  • Transcriptomic evidence: Gene expression changes in response to benzoate included upregulation of formate dehydrogenases and amino acid transporters that may contribute to pH homeostasis during acid stress .

For detailed energetic studies of the putative anionic 4-hydroxy-benzoate permease, researchers could:

  • Measure transport in the presence of protonophores or ionophores

  • Compare transport rates in membrane vesicles with artificially imposed ion gradients

  • Perform electrophysiological measurements to detect charge movement during transport

  • Use fluorescent pH indicators to correlate substrate transport with changes in internal pH

How do mutations in conserved residues affect the function of anionic compound permeases?

While specific mutational analyses of the putative anionic 4-hydroxy-benzoate permease are not described in the provided literature, research on related membrane transporters suggests several approaches for investigating structure-function relationships:

Results from such studies would provide mechanistic insights into how this class of permeases recognizes and transports aromatic compounds across membranes.

What are the challenges in crystallization and structural determination of membrane permeases?

Membrane proteins like the putative anionic 4-hydroxy-benzoate permease present unique challenges for structural determination:

  • Expression and purification challenges:

    • Low natural abundance requiring recombinant overexpression

    • Potential toxicity to expression hosts

    • Requirement for detergents that may destabilize the protein

    • Maintaining stability during purification

  • Crystallization difficulties:

    • Detergent micelles limit crystal contacts

    • Conformational heterogeneity reduces crystal order

    • Limited polar surface area for crystal lattice formation

    • Finding conditions that maintain native conformation

  • Data collection and processing issues:

    • Membrane protein crystals often diffract poorly

    • High solvent content leads to radiation damage

    • Phase determination may be challenging due to lack of molecular replacement models

  • Alternative approaches to overcome these challenges:

    • Crystallization in lipidic cubic phases

    • Antibody fragment co-crystallization to increase polar surface area

    • Thermostabilizing mutations to reduce conformational flexibility

    • Cryo-electron microscopy (avoiding crystallization altogether)

For the putative anionic 4-hydroxy-benzoate permease specifically, researchers could leverage the recombinant His-tagged protein as a starting point, optimizing:

  • Detergent screening for stability

  • Lipid supplementation to maintain native-like environment

  • Nanobody or antibody co-crystallization

  • Fusion partners to facilitate crystallization

How can computational modeling inform experimental design for permease research?

Computational modeling provides valuable insights for designing experiments on the putative anionic 4-hydroxy-benzoate permease:

  • Homology modeling applications:

    • Predict 3D structure based on related transporters

    • Identify potential substrate binding sites

    • Guide mutagenesis experiments by highlighting functionally important residues

    • Suggest conformational changes during transport cycle

  • Molecular dynamics simulations:

    • Model permease behavior in membrane environments

    • Predict water and ion pathways through the protein

    • Estimate energetics of substrate binding and transport

    • Simulate effects of pH on protein structure and function

  • Docking and virtual screening:

    • Predict binding modes of known substrates

    • Screen compound libraries for potential substrates or inhibitors

    • Estimate relative binding affinities

    • Guide design of substrate analogs for mechanistic studies

  • Integrative computational-experimental workflow:

    • Generate hypotheses via computational modeling

    • Test predictions through targeted experiments

    • Refine models based on experimental results

    • Iterate between computation and experiment

For the specific permease under study, computational analysis of the amino acid sequence could predict:

  • Number and arrangement of transmembrane helices

  • Location of substrate binding sites

  • Residues involved in proton coupling

  • Conformational changes during transport cycle

This information would guide the design of site-directed mutagenesis experiments, substrate specificity studies, and functional assays.

How do researchers quantify permease-mediated transport in different experimental systems?

Quantifying permease-mediated transport requires sophisticated experimental approaches that vary depending on the research context:

  • Whole-cell transport assays:

    • Radiolabeled substrate uptake: Measuring accumulation of labeled compounds in cells

    • Fluorescence-based methods: Using fluorescent substrates or pH-sensitive fluorophores

    • Growth-based assays: Comparing growth rates with the substrate as the sole carbon source

    • pH-dependent studies: Assessing transport at different pH values to distinguish permease-mediated from passive transport

  • Membrane vesicle systems:

    • Right-side-out vesicles: For studying import

    • Inside-out vesicles: For studying export or energetics

    • Control of membrane potential and ion gradients

    • Time-resolved measurements of transport kinetics

  • Reconstituted systems:

    • Proteoliposomes containing purified permease

    • Defined lipid composition and buffer conditions

    • Precise control of substrate and ion concentrations

    • Measurement of counterflow or exchange transport

  • Advanced biophysical approaches:

    • Solid-supported membrane electrophysiology

    • Surface plasmon resonance for binding studies

    • Isothermal titration calorimetry for thermodynamics

    • NMR for dynamic structural changes during transport

For the putative anionic 4-hydroxy-benzoate permease, the BenK study provides a methodological framework. The researchers demonstrated permease function by:

  • Comparing growth of wild-type and permease-deficient strains

  • Testing growth at different pH values to distinguish active transport from diffusion

  • Assessing growth with different substrates to determine specificity

These approaches could be adapted and expanded for detailed characterization of the 4-hydroxy-benzoate permease.

What are the best practices for troubleshooting expression and activity issues with recombinant permeases?

Researchers working with recombinant putative anionic 4-hydroxy-benzoate permease may encounter several technical challenges. The following troubleshooting framework addresses common issues:

Expression Problems:

IssuePotential CausesSolutions
Low expression levelToxicity to hostUse tightly controlled inducible systems; try lower induction levels
Codon biasOptimize codons for expression host; use specialized strains
mRNA stabilityCheck for rare codons or secondary structures in mRNA
Inclusion body formationImproper foldingLower induction temperature (16-20°C); co-express chaperones
Excessive expression rateReduce inducer concentration; use weaker promoters
HydrophobicityUse specialized E. coli strains (C41/C43); add solubilizing fusion partners

Purification Challenges:

IssuePotential CausesSolutions
Poor solubilizationIneffective detergentScreen different detergents (DDM, LMNG, digitonin)
Harsh conditionsOptimize temperature, time, and detergent concentration
Low yield after purificationProtein instabilityInclude stabilizing additives (glycerol, trehalose )
AggregationAdd lipids during purification; use mild detergents
Poor binding to affinity resinCheck tag accessibility; try different purification methods

Activity Assessment:

IssuePotential CausesSolutions
No detectable activityDenaturationVerify protein folding; try different reconstitution methods
Incorrect substrateTest multiple potential substrates
Missing cofactorsAdd potential cofactors or coupling ions
Inconsistent resultspH effectsControl pH carefully; test pH range for activity
Membrane compositionOptimize lipid composition in reconstitution
Competing transportersUse gene knockout strains for clean background

According to the product information, the recombinant protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and 5-50% glycerol should be added for long-term storage . Avoiding repeated freeze-thaw cycles is essential for maintaining activity .

How can researchers distinguish between specific and non-specific effects in permease inhibition studies?

When conducting inhibition studies with the putative anionic 4-hydroxy-benzoate permease, distinguishing specific from non-specific effects requires rigorous experimental controls and multiple complementary approaches:

  • Concentration-response relationships:

    • Specific inhibition typically shows defined dose-response curves

    • Non-specific effects often lack saturation or show very steep inhibition curves

    • Calculate IC50 values to compare potency of different inhibitors

  • Selectivity profiling:

    • Test inhibitors against related and unrelated transporters

    • Specific inhibitors affect only the target permease or closely related proteins

    • Non-specific inhibitors affect multiple transport systems

  • Mechanism-based approaches:

    • Determine type of inhibition (competitive, non-competitive, uncompetitive)

    • Competitive inhibitors likely bind the substrate site

    • Analyze structure-activity relationships of inhibitors

  • Controls for membrane effects:

    • Monitor membrane integrity (fluorescent dyes, electrical properties)

    • Measure effects on membrane fluidity

    • Test general membrane permeabilization using probe substrates

  • Biological validation:

    • Compare effects on transport with effects on bacterial growth

    • Determine if inhibition can be overcome by increasing substrate concentration

    • Test for reversibility of inhibition

For example, when studying the pH-dependence of transport (as done with BenK ), researchers should control for:

  • Direct effects of pH on substrate protonation

  • Changes in membrane properties at different pH values

  • Effects on cellular metabolism or energy state

  • Potential pH-dependent conformational changes in the permease

What are the most effective methods for studying permease-substrate interactions in vitro?

Investigating interactions between the putative anionic 4-hydroxy-benzoate permease and its substrates requires sophisticated biophysical and biochemical approaches:

  • Direct binding assays:

    • Isothermal titration calorimetry (ITC): Measures heat changes during binding to determine affinity constants (Kd), stoichiometry, and thermodynamic parameters

    • Surface plasmon resonance (SPR): Detects real-time binding kinetics (kon, koff)

    • Microscale thermophoresis (MST): Measures changes in thermophoretic mobility upon binding

    • Fluorescence-based assays: Using intrinsic tryptophan fluorescence or fluorescent substrate analogs

  • Structural approaches:

    • X-ray crystallography with bound substrate or substrate analogs

    • Cryo-EM to capture different conformational states during transport

    • NMR to detect substrate-induced conformational changes

    • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in substrate binding

  • Competition assays:

    • Displacement of labeled substrate by unlabeled compounds

    • Comparison of structurally related compounds to define pharmacophore

    • Determination of structure-activity relationships

  • Functional reconstitution:

    • Proteoliposomes with purified permease

    • Transport measurements under defined conditions

    • Correlation of binding data with transport activity

  • Computational approaches:

    • Molecular docking to predict binding modes

    • Molecular dynamics simulations to analyze binding stability

    • Free energy calculations to estimate binding affinity

These methods should be applied to the purified recombinant permease , with careful consideration of the detergent environment or reconstituted membrane system to maintain native-like conditions.

What emerging technologies might advance research on bacterial permeases?

Several cutting-edge technologies hold promise for deepening our understanding of the putative anionic 4-hydroxy-benzoate permease and related transporters:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy (cryo-EM): Enabling visualization of membrane proteins without crystallization

    • Micro-electron diffraction (microED): For structure determination from nanocrystals

    • Time-resolved X-ray crystallography: To capture transient states during transport

    • Serial femtosecond crystallography: Using X-ray free-electron lasers to study dynamics

  • Single-molecule techniques:

    • Single-molecule FRET: Monitoring conformational changes in real-time

    • Atomic force microscopy: Directly measuring forces during substrate binding

    • Optical tweezers: Studying mechanical properties during transport cycles

    • Nanopore-based approaches: Single-molecule electrophysiology

  • Advanced genomic and transcriptomic methods:

    • CRISPR-Cas9 genome editing: Precise genetic manipulation to study permease function

    • RNA-seq and ribosome profiling: Comprehensive analysis of gene expression regulation

    • ChIP-seq: Identifying transcription factor binding sites controlling permease expression

    • Single-cell transcriptomics: Examining cell-to-cell variability in permease expression

  • Computational advances:

    • AI-based structure prediction (AlphaFold2, RoseTTAFold)

    • Accelerated molecular dynamics simulations

    • Quantum mechanics/molecular mechanics (QM/MM) for reaction mechanisms

    • Systems biology models integrating permease function with cellular metabolism

These technologies could address fundamental questions about the anionic 4-hydroxy-benzoate permease, including its transport mechanism, substrate specificity determinants, and integration with cellular metabolism.

How might understanding permease function inform biotechnological applications?

Research on the putative anionic 4-hydroxy-benzoate permease has significant implications for biotechnology:

  • Bioremediation applications:

    • Enhanced uptake of aromatic pollutants through permease engineering

    • Development of bacterial biosensors for environmental monitoring

    • Improved degradation of recalcitrant aromatic compounds

    • Metabolic engineering of biodegradation pathways

  • Metabolic engineering for bioproduction:

    • Enhancing precursor uptake for aromatic compound biosynthesis

    • Engineering substrate specificity for novel feedstock utilization

    • Improving export of valuable aromatic products

    • Balancing import/export to optimize intracellular concentrations

  • Synthetic biology applications:

    • Creating permease-based logic gates for synthetic circuits

    • Developing inducible systems based on permease-substrate interactions

    • Engineering orthogonal transport systems for synthetic compartmentalization

    • Creating artificial symbiotic relationships through complementary transport systems

  • Drug development and delivery:

    • Targeting bacterial permeases for antimicrobial development

    • Using permeases to enhance uptake of therapeutic compounds

    • Developing permease inhibitors as adjuvants to existing antibiotics

    • Engineering bacterial delivery vectors for therapeutic compounds

Understanding the structure-function relationships of the anionic 4-hydroxy-benzoate permease could enable rational design of variants with altered substrate specificity, improved transport efficiency, or novel regulatory properties for these biotechnological applications.

What interdisciplinary approaches might yield new insights into permease biology?

Understanding the full complexity of the putative anionic 4-hydroxy-benzoate permease requires integrative approaches spanning multiple disciplines:

For the putative anionic 4-hydroxy-benzoate permease, these interdisciplinary approaches could reveal:

  • How sequence variations across different bacterial species affect substrate specificity

  • The evolutionary pressures driving permease specialization

  • The ecological niches where specific transport capabilities provide selective advantages

  • Novel applications in synthetic biology and biotechnology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.