Recombinant Putative antiporter subunit mnhB2 (mnhB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mnhB2; mrpB2; Putative antiporter subunit mnhB2; Mrp complex subunit B2; Putative NADH-ubiquinone oxidoreductase subunit mnhB2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Staphylococcus aureus
Target Names
mnhB2
Target Protein Sequence
MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS
Uniprot No.

Target Background

Function

The mnh2 operon expressed in E. coli does not exhibit Na+Li+/H+ antiport activity. However, it confers increased growth rates compared to control strains at pH values up to 9.5. The operon may encode an NADH-ubiquinone oxidoreductase.

Protein Families
CPA3 antiporters (TC 2.A.63) subunit B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of mnhB2 in Staphylococcus aureus?

The mnhB2 protein functions as a subunit of the Mrp antiporter complex, which is essential for bacterial adaptation to pH fluctuations and cation stress conditions. Mrp antiporters facilitate cation/proton exchange across bacterial membranes, allowing halophilic and alkaliphilic bacteria to maintain homeostasis in challenging environments . This protein has been identified as a putative NADH-ubiquinone oxidoreductase subunit as well as an Mrp complex subunit B2, suggesting its involvement in energy-dependent ion transport processes .

When examining mnhB2 function, researchers should consider its relationship to the larger Mrp complex architecture and the interconnected roles of individual subunits. The protein plays a specific role within the multisubunit complex that enables coordinated ion movement across the membrane. Functional studies often require examination of the entire complex rather than isolated subunits to understand physiological relevance.

How does mnhB2 relate to other components of the Mrp antiporter complex?

The mnhB2 protein is one subunit within the multi-component Mrp antiporter complex, which typically consists of seven membrane subunits (MrpA to MrpG). Within this complex, mnhB2 works in coordination with other subunits to facilitate ion transport. The Mrp complex represents a specialized ion transport system that shares evolutionary relationships with respiratory complex I .

Significantly, research has shown that the Mrp antiporter structure resolves more than 99% of the sidechains of the seven membrane subunits plus approximately 360 water molecules, including roughly 70 in putative ion translocation pathways . This complex organization enables sophisticated ion transport mechanisms that rely on coordinated interactions between multiple subunits including mnhB2.

Experimental approaches to study these relationships often require techniques that preserve native protein-protein interactions, such as co-immunoprecipitation, cross-linking studies, or native gel electrophoresis. Understanding the specific contribution of mnhB2 requires consideration of its structural and functional integration within the larger complex.

What are the optimal conditions for expressing recombinant mnhB2 protein?

When expressing recombinant mnhB2, researchers must carefully optimize bacterial expression systems to accommodate the hydrophobic nature of this membrane protein. While specific expression conditions for mnhB2 are not directly provided in the search results, established protocols for similar membrane proteins suggest using specialized expression strains (such as C41(DE3) or C43(DE3)) that are designed for toxic or membrane protein expression.

For purification, the use of detergents or nanodiscs may be necessary to maintain the protein in its native conformation. Based on standard practices for similar proteins, researchers typically store the purified protein in Tris-based buffer with 50% glycerol at -20°C for regular use or -80°C for extended storage . It's advisable to avoid repeated freeze-thaw cycles and instead prepare working aliquots that can be stored at 4°C for up to one week .

When designing expression experiments, consider implementing a randomized block design to control for variation between expression batches. This approach helps neutralize systematic biases and ensures that observed differences in protein yield or activity are attributable to the experimental variables rather than batch effects .

What experimental approaches are most effective for studying ion transport mechanisms in mnhB2?

For investigating ion transport mechanisms mediated by mnhB2, multiple complementary approaches should be employed. Molecular dynamics (MD) simulations have proven valuable for revealing mechanistic details, as demonstrated in studies of related Mrp antiporters where MD simulations uncovered critical information about histidine-switch mechanisms in proton transfer .

Experimental validation can be achieved through site-directed mutagenesis of conserved residues followed by functional assays that measure ion transport. The creation of fluorescent protein fusions or the use of ion-sensitive dyes can allow real-time monitoring of transport activity in living cells. Additionally, electrophysiological methods such as patch-clamp techniques or reconstitution into lipid bilayers may provide direct measurements of ion movement.

When designing these experiments, it's crucial to implement appropriate controls and sufficient replication. As noted in experimental design principles, "A good experimental design is characterized by the absence of systematic error. Experimental units should not differ in any systematic way from one another" . For mnhB2 studies, this might mean carefully controlling variables such as membrane potential, pH, ion concentrations, and the presence of other cellular components that might influence transport activity.

How can researchers optimize experimental design when investigating mnhB2 function in different bacterial strains?

When investigating mnhB2 function across different bacterial strains, researchers should employ a strategic experimental design that allows for rigorous comparison while controlling for strain-specific variables. A randomized block design where each block represents a different experimental condition (e.g., pH, salt concentration) can help isolate the effects of strain variation from other experimental factors .

For quantitative assessment of mnhB2 function, researchers should carefully select the number and spacing of treatment levels: "Separation of levels at equal intervals can facilitate comparisons and interpretation. The number of levels sets the limit on the detectable complexity of the response" . This is particularly important when measuring ion transport across a range of conditions.

Statistical power calculations should guide determination of sample sizes to ensure detection of biologically significant differences. Remember that "with sufficient replication, a difference can always be found," but the key is to define "biological significance" and design experiments to detect meaningful effects . For mnhB2 functional studies, this might involve determining what magnitude of change in ion transport capacity would have physiological consequences for the bacteria.

How can machine learning approaches enhance experimental design for mnhB2 structure-function studies?

Machine learning (ML) approaches offer powerful tools for optimizing experimental design in mnhB2 structure-function studies. Bayesian Optimal Experimental Design (BOED) combined with ML can identify experimental conditions that maximize information gain about specific aspects of mnhB2 function . This approach allows researchers to efficiently determine which protein variants or experimental conditions will be most informative for understanding structure-function relationships.

The workflow for implementing ML-based BOED includes: defining a scientific goal (e.g., determining which structural features of mnhB2 are critical for ion selectivity), formalizing computational models that can be sampled from, setting up the design optimization problem, constructing and training ML models with simulated data, and validating the obtained optimal designs .

One significant advantage of this approach is that it produces not only optimized experimental designs but also "tractable amortized posterior inference"—allowing researchers to easily compute posterior distributions from their experimental data, which may otherwise be computationally expensive or intractable . This is particularly valuable for membrane proteins like mnhB2, where traditional structural and functional analyses can be challenging and resource-intensive.

What are the key considerations for studying conformational changes in mnhB2 during ion transport?

Studying conformational changes in mnhB2 during ion transport requires specialized approaches due to the dynamic nature of these changes. High-resolution cryo-EM has proven effective for related Mrp antiporters, revealing alternative conformations of key residues involved in ion transport . For instance, in related Mrp complexes, residues like Glu409 and Lys408 in the MrpA subunit show alternative sidechain positions at putative periplasmic proton entry sites .

When designing experiments to capture these conformational changes, researchers should consider time-resolved approaches that can detect transient states. This might include the use of rapid-mixing devices coupled with spectroscopic methods or time-resolved cryo-EM. Molecular dynamics simulations can complement experimental approaches by predicting conformational changes that might be difficult to capture experimentally.

The experimental design should include careful consideration of how to trap the protein in different conformational states, possibly using inhibitors, substrate analogs, or mutations that stabilize specific conformations. As noted in experimental design principles, "The experiment is designed so that one can calculate the possibility of obtaining the observed results by chance alone" . For conformational studies, this means implementing controls that can distinguish genuine conformational changes from artifacts or random fluctuations.

How can researchers effectively investigate the role of conserved histidine residues in the ion transport mechanism of Mrp antiporters including mnhB2?

Investigation of conserved histidine residues in Mrp antiporters requires a multifaceted approach that combines computational modeling with experimental validation. Studies on related Mrp antiporters have revealed that "switching the position of a histidine residue between three hydrated pathways in the MrpA subunit is critical for proton transfer that drives gated trans-membrane sodium translocation" .

To investigate similar mechanisms potentially involving mnhB2, researchers should first identify conserved histidine residues through sequence alignment across Mrp family members. Site-directed mutagenesis can then be employed to systematically alter these residues, followed by functional assays to assess the impact on ion transport. Complementary approaches might include pH-dependent spectroscopic studies to determine the pKa values of key histidine residues, providing insight into their protonation states under different conditions.

Molecular dynamics simulations can model the behavior of water molecules and ions within the transport pathways, similar to studies that identified "three hydrated pathways in the MrpA subunit" critical for the histidine-switch mechanism . These computational approaches should be validated with experimental measurements of proton and sodium transport under varying pH and ion concentration conditions.

What statistical approaches are most appropriate for analyzing ion transport data from mnhB2 functional studies?

When analyzing ion transport data from mnhB2 functional studies, researchers should employ statistical approaches that account for the complex, often non-linear nature of transport kinetics. Mixed-effects models are particularly valuable as they can account for both fixed effects (experimental treatments) and random effects (batch-to-batch variation in protein preparation or cell culture).

For time-series data tracking ion movement, repeated measures ANOVA or longitudinal data analysis approaches may be appropriate. When comparing multiple experimental conditions, researchers should be cautious about multiple comparisons: "With a 5% Type I error rate and 200 comparisons, one can expect about 10 false positives (Type I errors). Thus it is important to be clear and strategic about your experimental objective" .

Advanced Bayesian approaches can be particularly valuable when incorporating prior knowledge about protein structure and function. As noted in discussions of machine learning for experimental design, these approaches "allow researchers to use their actual experimental data to easily compute posterior distributions, which may otherwise be computationally expensive or intractable to compute" .

How can researchers address contradictory findings when studying mnhB2 function across different experimental systems?

Addressing contradictory findings about mnhB2 function requires careful consideration of experimental context and potential sources of variation. When contradictions arise, researchers should first examine differences in experimental systems, including bacterial strains, expression conditions, and assay methodologies.

A systematic approach involves reproducing the contradictory results within a single experimental framework, controlling as many variables as possible. This might include obtaining the exact bacterial strains, plasmids, or protein constructs used in previous studies and testing them side-by-side under identical conditions.

Meta-analysis techniques can help integrate findings across studies, identifying factors that contribute to heterogeneity in results. When designing follow-up experiments, researchers should employ factorial designs that can explicitly test the interaction between experimental factors that might explain contradictory findings. As noted in experimental design principles, "The experiment is designed so that it one can calculate the possibility of obtaining the observed results by chance alone" . This approach helps distinguish genuine biological variation from methodological artifacts.

How can structural information about mnhB2 be leveraged for antimicrobial drug development targeting Staphylococcus aureus?

Structural information about mnhB2 can be leveraged for antimicrobial drug development through structure-based drug design approaches. Since Mrp antiporters are essential for bacterial adaptation to stress conditions, inhibitors targeting mnhB2 could potentially compromise bacterial survival in the host environment.

The high-resolution structural data available for related Mrp complexes, which has "resolved more than 99% of the sidechains of the seven membrane subunits MrpA to MrpG plus 360 water molecules, including ~70 in putative ion translocation pathways" , provides templates for modeling the structure of mnhB2. Computational approaches including molecular docking and virtual screening can identify compounds predicted to bind to critical sites within mnhB2, particularly focusing on regions involved in ion transport.

When designing experiments to validate potential inhibitors, researchers should implement a systematic screening approach that progresses from in vitro binding and functional assays to cellular assays measuring bacterial survival under stress conditions. The experimental design should include appropriate controls for compound specificity, testing effects on both target bacteria and mammalian cells to assess selective toxicity. The progression from in vitro to in vivo studies should follow a logical sequence with increasing biological complexity, ultimately testing promising compounds in infection models.

What are the methodological considerations for studying the role of mnhB2 in bacterial biofilm formation and antibiotic resistance?

Investigating the role of mnhB2 in biofilm formation and antibiotic resistance requires specialized methodologies that bridge molecular mechanisms with community-level phenotypes. Researchers should develop isogenic mutant strains with controlled expression of mnhB2 (knockout, knockdown, or overexpression) to directly assess its contribution to biofilm development and antibiotic susceptibility.

Experimental designs should incorporate multiple complementary approaches to biofilm quantification, including crystal violet staining, confocal microscopy with fluorescent stains, and biomass measurement. When assessing antibiotic resistance, both planktonic minimum inhibitory concentration (MIC) testing and biofilm-specific measures like minimum biofilm eradication concentration (MBEC) should be employed.

The experimental design should include careful consideration of environmental conditions that influence both biofilm formation and mnhB2 function, such as pH, ion concentrations, and nutrient availability. A factorial design that systematically varies these conditions can reveal context-dependent roles of mnhB2. When analyzing results, multivariate statistical approaches may be necessary to untangle the complex relationships between gene expression, ion homeostasis, biofilm structure, and antibiotic resistance. As noted in experimental design principles, "A good experimental design is as simple as possible for the desired objective" , so researchers should carefully prioritize the most informative experimental conditions rather than attempting exhaustive testing of all possible variables.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.