Recombinant Putative antiporter subunit mnhC2 (mnhc2)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Bacterial Physiology

The Mrp antiporter, including mnhC2, facilitates Na+/H+ exchange, enabling bacterial survival under high salinity, alkaline pH, and oxidative stress. Key functions include:

  • Ion Homeostasis: Maintains intracellular pH and sodium levels via electroneutral antiport .

  • Pathogenicity: Critical for S. aureus virulence, likely through stress adaptation in host environments .

  • Structural Stability: mnhC2 stabilizes the MrpABCDEFG complex; mutations (e.g., MrpC-Q70A) disrupt complex assembly and reduce antiport activity .

Research Findings and Mutational Analysis

Studies using recombinant mnhC2 have revealed insights into its role in ion transport and complex dynamics:

Key Mutations and Phenotypic Effects

MutationEffect on ActivityImpact on Complex StabilitySource
MrpC-Q70ARetains partial Na+/H+ activityDisrupts MrpABCD–EFG interactions
MrpC-G82IReduces activity by ~70%No effect on complex formation
MrpC-terminal truncationComplete loss of activityPrevents complex assembly

These findings highlight mnhC2’s role in both catalytic efficiency and structural integrity of the Mrp complex .

Applications in Research and Industry

Recombinant mnhC2 is commercially available for biochemical and pharmacological studies:

Homology and Evolutionary Significance

mnhC2 shares evolutionary links with respiratory complex I subunits (e.g., NuoK), suggesting a conserved mechanism for coupling ion transport to metabolic processes . Structural models propose that mnhC2 collaborates with MrpA and MrpD subunits to form ion pathways, analogous to proton-pumping modules in complex I .

Future Directions

Ongoing research aims to:

  • Resolve the atomic structure of the full Mrp complex using recombinant subunits like mnhC2 .

  • Develop inhibitors targeting mnhC2 to combat S. aureus infections .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Store aliquots at -20°C or -80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is dependent on several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C or -80°C. For lyophilized form, the shelf life is 12 months at -20°C or -80°C.
Storage Condition
Store at -20°C or -80°C upon receipt. Aliquot the protein for multiple uses to minimize repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mnhc2; mrpC2; Putative antiporter subunit mnhC2; Mrp complex subunit C2; Putative NADH-ubiquinone oxidoreductase subunit mnhC2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Staphylococcus aureus
Target Names
mnhc2
Target Protein Sequence
MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK
Uniprot No.

Target Background

Function
Expression of the mnh2 operon in E. coli does not exhibit Na(+)Li(+)/H(+) antiport activity. However, it does lead to higher growth rates compared to the control strain at pH levels up to 9.5. The operon may encode an NADH-ubiquinone oxidoreductase.
Protein Families
CPA3 antiporters (TC 2.A.63) subunit C family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the mnhC2 subunit and what is its role in the multisubunit Na+/H+ antiporter system?

The mnhC2 subunit, along with the other subunits, appears to be necessary for the functional expression of Na+/H+ antiporter activity. Research has demonstrated that all seven subunits are required for antiporter function, as deletion experiments removing portions of the gene cluster resulted in loss of Na+/H+ antiport activity .

How does the mnh antiporter system differ from other bacterial Na+/H+ antiporters?

The mnh antiporter system represents a novel type of Na+/H+ antiporter with distinct properties compared to other well-characterized bacterial antiporters:

Antiporter TypeOptimal pH ActivityStructureKey Characteristics
mnh (S. aureus)pH 7.0-7.5Multisubunit (7 subunits)Activity measurable at neutral pH
NhaA (E. coli/V. parahaemolyticus)pH 8.5Single protein (~12 transmembrane domains)Negligible activity at pH 7.0, high at alkaline pH
NhaB (E. coli/V. parahaemolyticus)Increases with alkalinitySingle protein (~12 transmembrane domains)Measurable at pH 7.0, higher at pH 8.0-8.5
ChaA (E. coli)--Single proteinEfficiently utilizes Ca²⁺ as substrate

The mnh antiporter system exhibits maximal activity at pH 7.0-7.5, which is notably different from the pH profile of NhaA, NhaB, and ChaA systems. Additionally, unlike ChaA, the mnh system does not show significant Ca²⁺/H⁺ antiport activity .

What experimental evidence confirms the function of the mnhC2 subunit in Na+/H+ antiport activity?

While the search results don't specifically isolate the function of mnhC2 alone, experimental evidence for the functional role of the entire mnh gene cluster includes:

  • Complementation studies: E. coli cells lacking Na+/H+ antiporters (KNabc strain) were transformed with plasmids containing the mnh gene cluster, which restored growth in media containing high concentrations of NaCl (up to 0.8 M) or LiCl (up to 0.4 M) .

  • Direct measurement of antiport activity: Na+/H+ antiport activity was detected in membrane vesicles prepared from transformants expressing the mnh genes but not in control vesicles .

  • Deletion analysis: Studies using various deletion plasmids demonstrated that most of the DNA insert (about 6 kbp containing the seven ORFs) was necessary for growth in the presence of 0.2 M NaCl, indicating that all subunits contribute to function .

What are the optimal conditions for expressing recombinant mnhC2 in heterologous systems?

Based on experimental findings with the entire mnh antiporter system, researchers have successfully expressed functional mnh genes in heterologous E. coli systems. For optimal expression of recombinant mnhC2:

  • Expression vector selection: pUC19 and pBR322 vectors have been successfully used for expressing mnh genes in E. coli .

  • Host strain considerations: Na+/H+ antiporter-deficient strains like KNabc are ideal for functional studies as they provide a clean background for assessing antiport activity .

  • Expression conditions: The complete mnh operon, including the mnhC2 subunit, appears to be expressed under the control of its native promoter in E. coli, suggesting that standard growth conditions for E. coli (37°C in LB media) may be suitable .

  • Co-expression requirements: Given that the seven subunits form an operon and appear to function together, optimal functional expression of mnhC2 likely requires co-expression of the other mnh subunits .

What methodologies are most effective for measuring mnhC2 contribution to Na+/H+ antiport activity?

To effectively measure the contribution of mnhC2 to Na+/H+ antiport activity, researchers can employ several methodologies:

  • Preparation of everted membrane vesicles:

    • Harvest cells at mid-logarithmic phase

    • Wash cells with appropriate buffer

    • Disrupt cells via French press or sonication

    • Prepare membrane vesicles through differential centrifugation

    • Resuspend vesicles in appropriate buffer containing respiratory substrates

  • Direct measurement of Na+/H+ antiport activity:

    • Establish a pH gradient (acidic inside) using respiratory substrates

    • Monitor Na+ or Li+ uptake using specific indicators or isotopes

    • Measure antiport activity at various pH values (pH 7.0-7.5 is optimal for mnh system)

    • Assess specificity by comparing Na+ versus Li+ transport rates

  • Site-directed mutagenesis approach:

    • Create specific mutations in mnhC2 while maintaining the integrity of the other subunits

    • Express the modified operon in antiporter-deficient cells

    • Assess growth under high salt conditions

    • Measure antiport activity in membrane vesicles

    • Compare with wild-type activity to determine the contribution of specific residues

How can researchers differentiate the specific roles of individual mnh subunits in the multisubunit antiporter complex?

Differentiating the specific roles of individual subunits in the multisubunit antiporter complex requires sophisticated experimental approaches:

What controls should be included when studying recombinant mnhC2 function?

When designing experiments to study recombinant mnhC2 function, several crucial controls should be included:

  • Negative controls:

    • Host cells without the recombinant plasmid

    • Host cells with empty vector

    • Host cells expressing mnhC2 with inactivating mutations

    • Membrane vesicles from control cells to establish baseline activity

  • Positive controls:

    • Host cells expressing the complete mnh operon

    • Host cells expressing well-characterized Na+/H+ antiporters (e.g., NhaA or NhaB)

    • Membrane vesicles treated with known ionophores that facilitate Na+/H+ exchange

  • Specificity controls:

    • Assess transport of different cations (Na+, Li+, K+, Ca2+)

    • Include proton conductors (e.g., CCCP) to confirm the H+-dependency of transport

    • Test activity at various pH values to establish pH profile

How can quasi-experimental study designs be applied to investigate mnhC2 function in complex biological systems?

While quasi-experimental designs are more commonly used in medical informatics and clinical research, certain principles can be adapted for studying mnhC2 function in complex biological systems:

  • One-group pretest-posttest design:

    • Measure baseline Na+/H+ antiport activity in a bacterial system

    • Introduce recombinant mnhC2 expression

    • Measure post-expression antiport activity

    • This design can help establish whether mnhC2 introduction changes antiport function

  • Repeated-treatment design:

    • Measure baseline activity

    • Introduce mnhC2 expression and measure activity

    • Remove mnhC2 expression (e.g., through repressible promoter systems) and measure activity

    • Reintroduce mnhC2 expression and measure activity again

    • This approach can provide stronger evidence for the causal role of mnhC2

  • Interrupted time-series design:

    • Measure antiport activity at multiple timepoints before mnhC2 induction

    • Induce mnhC2 expression

    • Measure antiport activity at multiple timepoints after induction

    • This approach helps control for temporal trends unrelated to mnhC2 expression

What approaches can be used to resolve conflicting data regarding mnhC2 function?

When faced with conflicting data regarding mnhC2 function, researchers can employ several approaches to resolve discrepancies:

  • Systematic variation of experimental conditions:

    • Test function across a range of pH values, salt concentrations, and temperatures

    • Examine effects of different expression systems and host backgrounds

    • Consider the influence of post-translational modifications or protein folding issues

  • Independent method validation:

    • Apply multiple independent techniques to measure the same function

    • For example, complement growth assays with direct transport measurements in vesicles

    • Validate protein expression using multiple detection methods (Western blot, mass spectrometry)

  • Collaborative cross-laboratory validation:

    • Engage multiple independent laboratories to replicate key experiments

    • Standardize protocols and reagents to minimize technical variability

    • Pool data for meta-analysis to identify sources of variability

How should researchers analyze kinetic data for mnhC2-containing antiporter complexes?

Analysis of kinetic data for mnhC2-containing antiporter complexes requires several specialized approaches:

  • Enzyme kinetics modeling:

    • Determine initial rates of transport under varying substrate concentrations

    • Generate Michaelis-Menten or Hill plots to determine Km, Vmax, and cooperativity

    • Compare kinetic parameters between wild-type and mnhC2-mutant complexes

  • pH-dependent activity analysis:

    • Measure antiport activity across a range of pH values (e.g., pH 6.0-9.0)

    • Plot activity versus pH to generate pH profile curves

    • Determine pH optima and compare with other antiporter systems

    • The mnh system shows maximal activity at pH 7.0-7.5, unlike NhaA or NhaB systems

  • Inhibitor studies analysis:

    • Measure antiport activity in the presence of various inhibitors

    • Generate dose-response curves and determine IC50 values

    • Use inhibitor sensitivity patterns to infer mechanistic details of transport

What bioinformatic approaches are useful for predicting mnhC2 structure and function?

Several bioinformatic approaches can help predict mnhC2 structure and function:

  • Sequence homology analysis:

    • Identify homologs through BLAST searches

    • Perform multiple sequence alignments to identify conserved regions

    • Search for functional domains and motifs

    • The mnh subunits show sequence similarity with components of the respiratory chain, suggesting potential evolutionary relationships

  • Hydropathy profiling:

    • Generate hydropathy plots to identify transmembrane domains

    • Predict membrane topology (orientation of N- and C-termini)

    • All mnh subunits appear to be hydrophobic based on hydropathy analysis

  • Structural prediction:

    • Use homology modeling if structural homologs exist

    • Apply ab initio modeling for novel structures

    • Predict protein-protein interaction interfaces

    • Validate predictions through experimental approaches like site-directed mutagenesis

What are the main challenges in purifying functional recombinant mnhC2 protein, and how can they be overcome?

Purifying functional membrane proteins like mnhC2 presents several challenges:

  • Protein solubilization challenges:

    • Solution: Test multiple detergents (DDM, LMNG, digitonin) for optimal solubilization

    • Alternative: Consider using amphipols or nanodiscs to maintain native-like lipid environment

    • Optimize detergent:protein ratios to prevent protein aggregation

  • Protein stability issues:

    • Solution: Include stabilizing agents (glycerol, specific lipids) in purification buffers

    • Alternative: Develop thermostabilized variants through systematic mutagenesis

    • Consider purifying the entire multisubunit complex rather than individual subunits to maintain stability

  • Functional assessment challenges:

    • Solution: Reconstitute purified protein into proteoliposomes for functional assays

    • Alternative: Develop solid-supported membrane electrophysiology assays

    • Consider fluorescence-based assays using pH-sensitive or Na+-sensitive fluorophores

How can researchers effectively study the interactions between mnhC2 and other subunits of the antiporter complex?

To study interactions between mnhC2 and other subunits effectively:

  • Co-expression and co-purification strategies:

    • Express mnhC2 with affinity tags along with untagged partner subunits

    • Purify through affinity chromatography to capture interaction partners

    • Verify interactions through mass spectrometry or Western blotting

    • The seven ORFs of the mnh operon appear to function together as a complex

  • Crosslinking approaches:

    • Apply chemical crosslinkers to stabilize transient interactions

    • Use photo-crosslinking with unnatural amino acids for site-specific crosslinking

    • Analyze crosslinked products through mass spectrometry to identify interaction interfaces

  • FRET-based interaction assays:

    • Label mnhC2 and potential partner subunits with appropriate fluorophore pairs

    • Measure FRET efficiency to determine proximity and interaction

    • Perform competition experiments to determine binding specificity

What are the promising approaches for leveraging mnhC2 research in understanding bacterial salt tolerance and pH homeostasis?

Future research on mnhC2 could contribute to understanding bacterial adaptation mechanisms:

  • Comparative genomics approaches:

    • Compare mnh operons across diverse bacterial species

    • Correlate genetic variations with differences in salt tolerance

    • Identify species-specific adaptations in extreme halophiles

  • Systems biology integration:

    • Map the regulatory networks controlling mnh expression

    • Identify environmental sensors that modulate antiporter activity

    • Develop predictive models of bacterial pH and ion homeostasis

  • Structural biology advancements:

    • Determine high-resolution structures of the multisubunit complex

    • Identify ion binding sites and transport pathways

    • Elucidate the structural basis for pH dependence of transport activity

How might the study of mnhC2 contribute to our understanding of related transport systems in eukaryotes?

The study of mnhC2 could inform our understanding of eukaryotic transport systems:

  • Evolutionary relationship analysis:

    • Compare bacterial and eukaryotic antiporter systems

    • Identify conserved functional domains across kingdoms

    • Trace the evolutionary history of multisubunit transport complexes

  • Functional complementation studies:

    • Express mnhC2 in eukaryotic systems lacking specific transporters

    • Assess functional conservation across evolutionary distance

    • Identify critical residues conserved between bacterial and eukaryotic systems

  • Mechanistic insights transfer:

    • Apply insights from bacterial systems to understand more complex eukaryotic transporters

    • Develop hypotheses about eukaryotic transport mechanisms based on bacterial models

    • Use bacterial systems as simplified models for complex transport phenomena

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.