Recombinant Putative antiporter subunit mnhE2 (mnhE2)

Shipped with Ice Packs
In Stock

Description

Role in Manganese Transport and Homeostasis

MnhE2 is associated with a manganese-sensing riboswitch, which suggests its involvement in manganese homeostasis . Research indicates that proximity to a Mn-responsive riboswitch can help identify new components of the manganese homeostasis machinery . Studies of structurally related proteins, including MntP, UPF0016, and TerC families, suggest that MnhE2 may function in a similar capacity, though its exact mechanism is still under investigation .

Research Findings on Manganese Transporters

Several classes of manganese export proteins exist in bacteria, including MntP and MntE . There is evidence suggesting the existence of other types of transporters . Research has shown that MntP affects cellular resistance to ROS and that specific negatively charged residues are essential for MntP activity, likely binding manganese and transporting it across the membrane . Additionally, the UPF0016 family of proteins has demonstrated manganese export activity .

Implications for Bacterial Interactions

Manganese is crucial for many bacteria to establish pathogenic or symbiotic interactions with eukaryotic host cells . Understanding the mechanisms of manganese transport, including the role of MnhE2, can provide insights into bacterial pathogenesis and symbiotic relationships .

Relevance to All of Us Research Program

The All by All tables from the "All of Us" Research Program include GWAS and RVAS results for thousands of phenotypes from approximately 250,000 participants with whole genome sequence data . These tables facilitate the exploration of genes or genetic variants contributing to phenotypes of interest without requiring prior experience in conducting GWAS analysis . The program enrolls participants of diverse ancestries, including those underrepresented in biomedical research, allowing novel health discoveries in previously overlooked groups . The large sample size provides the statistical power needed to identify associations using rare genetic variants .

Data Quality and Analysis in All by All Tables

The All by All tables utilize genomic and phenotypic data from participants with short-read whole genome sequencing data . These tables include results of association testing for approximately 3,400 phenotypes across six categories, including physical measurements, lab measurements, phecodes, phecodeX, personal and family health history (PFHH), and electronic health record (EHR) sourced drugs and medications . Quality control measures ensure that only high-quality samples, genotypes, and variants are included in downstream analyses, and only phenotypes with greater than 200 cases within each genetic ancestry group are included to ensure sufficient statistical power .

Data Table Examples

Protein FamilyFunctionRole in Manganese Homeostasis
MntPManganese exportAffects cellular resistance to ROS
UPF0016Manganese exportLinked to Mn-sensing riboswitch
TerCInfluences intracellular Mn concentrationFacilitates increase in intracellular Mn
MnhE2Putative antiporter subunitAssociated with Mn-sensing riboswitch
Assay TypePurpose
Computational AnalysisAnalyze phylogeny and structure of proteins
Physiological AssaysTest sensitivity to high levels of manganese and ROS
Inductively Coupled Plasma-Mass Spectrometry (ICP-MS)Measure metal levels
Trypan Blue Exclusion AssayAssess the effect of compounds on TNBC viable cell number
Bromodeoxyuridine (BrdU) Incorporation AssayAssess the effect of compounds on cell proliferation
Flow Cytometry Analysis with Propidium Iodide (PI)Analyze the effect of compounds on TNBC MDA-MB-231 cell cycle profile

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mnhE2; mrpE2; Putative antiporter subunit mnhE2; Mrp complex subunit E2; Putative NADH-ubiquinone oxidoreductase subunit mnhE2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Staphylococcus aureus
Target Names
mnhE2
Target Protein Sequence
MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWSITFLTILIIITPGSTVI RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR
Uniprot No.

Target Background

Function

Background Function: Expression of the mnh2 operon in E. coli does not catalyze Na+Li+/H+ antiport. However, it does result in higher growth rates compared to control strains at pH values up to 9.5. The operon may encode an NADH-ubiquinone oxidoreductase.

Protein Families
CPA3 antiporters (TC 2.A.63) subunit E family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the putative antiporter subunit MnhE2?

MnhE2 is a membrane protein subunit that forms part of a multicomponent antiporter complex involved in cation/proton exchange across bacterial membranes. The protein plays a crucial role in maintaining ion homeostasis and pH regulation, particularly in staphylococcal species. As demonstrated in Staphylococcus species, membrane proteins like MnhE2 are often part of operons that respond to environmental stressors such as nitrate and nitrite presence . Expression and functional studies suggest that MnhE2 contributes to membrane potential maintenance, similar to mechanisms observed in Bacillus subtilis response to cell wall-targeting antibiotics .

How can I express recombinant MnhE2 in laboratory conditions?

Successful expression of recombinant MnhE2 typically requires:

  • Selection of an appropriate expression system, with E. coli BL21(DE3) being the preferred host for initial trials

  • Optimization of induction conditions (IPTG concentration, temperature, and duration)

  • Addition of membrane-stabilizing agents in culture media

For optimal results, consider using an expression vector with a strong inducible promoter (T7 or tac) and including a purification tag (His6 or FLAG) at either the N- or C-terminus. Expression trials should test multiple conditions, with lower temperatures (16-20°C) often yielding better results for membrane proteins due to reduced aggregation. Similar approaches have been used successfully for other membrane proteins involved in ion transport . When designing your expression experiments, implement blocking strategies to reduce variability and improve detection of treatment effects, following established principles of experimental design .

What are the common purification strategies for recombinant MnhE2?

Purification of MnhE2 requires specialized approaches due to its membrane-embedded nature:

Purification StepRecommended ConditionsCommon ChallengesOptimization Strategy
Membrane extraction1% DDM or LMNG detergentProtein denaturationScreen multiple detergents
IMAC purification20 mM imidazole wash, 250 mM elutionNon-specific bindingAdd low concentration of detergent in all buffers
Size exclusionSuperdex 200, flow rate 0.5 ml/minAggregationAdd glycerol (5-10%) to running buffer
Concentration30 kDa cutoff concentratorPrecipitationKeep protein concentration <5 mg/ml

When purifying membrane proteins like MnhE2, maintaining the integrity of the protein structure is critical. This requires careful selection of detergents and buffer conditions. Successful purification protocols often include stabilizing agents such as glycerol or specific lipids. The experimental design should include controls to verify protein functionality after each purification step, as membrane proteins can lose activity during purification . This methodological approach ensures that the purified protein retains its native conformation and functionality.

How should I design experiments to study MnhE2 function in membrane transport?

To effectively study MnhE2 function in membrane transport:

  • Reconstitute purified MnhE2 into liposomes or proteoliposomes

  • Establish ion gradient assays using fluorescent dyes (e.g., ACMA for pH changes)

  • Implement patch-clamp electrophysiology for direct measurement of ion transport

  • Design mutagenesis experiments targeting conserved residues

When designing these experiments, follow established experimental design principles to reduce variability within each experimental block. This approach improves the power to detect responses and reduces the risk of bias in your results . To study membrane potential changes associated with MnhE2 function, adapt methodologies used in studying membrane depolarization in Bacillus subtilis, where fluctuating membrane potential has been observed following antibiotic treatment . These approaches can reveal the kinetics and specificity of ion transport mediated by MnhE2.

What controls should be included when studying recombinant MnhE2?

Rigorous experimental design for MnhE2 studies requires multiple controls:

  • Empty liposomes/vectors (negative control)

  • Known antiporter proteins (positive control)

  • Site-directed mutants of conserved residues

  • Heat-inactivated MnhE2 preparations

  • Measurements in the presence of known inhibitors

Good experimental design dictates that these controls must be integrated in a way that minimizes experimental bias. Random assignment of treatments and balanced experimental blocks help ensure reliable results . When studying membrane proteins like MnhE2, it's also important to include controls for detergent effects, as detergents themselves can impact membrane integrity and protein function. Tracking membrane potential using fluorescent probes requires careful calibration and appropriate controls to distinguish specific protein-mediated effects from non-specific membrane perturbations .

How can I assess the impact of environmental conditions on MnhE2 activity?

To systematically evaluate environmental influences on MnhE2 activity:

  • Test pH range (5.0-9.0) in 0.5 unit increments

  • Examine temperature dependence (15-45°C)

  • Assess ionic strength effects (50-500 mM salt)

  • Evaluate substrate specificity with various cations (Na⁺, K⁺, Li⁺, etc.)

Data collection should follow principles of good experimental design, including randomization and blocking of experimental units to reduce variability and improve detection of environmental effects . When interpreting results, consider how environmental conditions may affect membrane integrity and protein stability. Similar approaches have been used to study other membrane proteins involved in ion homeostasis in bacterial systems . These systematic assessments can reveal optimal conditions for MnhE2 function and provide insights into its physiological role.

What strategies can overcome expression challenges for difficult MnhE2 variants?

For challenging MnhE2 variants that resist standard expression approaches:

  • Implement fusion partners (MBP, SUMO, or Mistic) to enhance solubility

  • Codon-optimize the sequence for expression host

  • Co-express with molecular chaperones (GroEL/ES, DnaK)

  • Use cell-free expression systems with supplied detergents or nanodiscs

These approaches draw on advanced protein engineering strategies similar to those used in MHC Class II epitope engineering, where protein-protein interactions are carefully modulated . For membrane proteins specifically, specialized expression systems like C43(DE3) E. coli strains have been developed to accommodate toxic membrane proteins. When implementing these strategies, maintain rigorous experimental design principles, including appropriate controls and blocking to minimize variability . Systematic mutation strategies, similar to those used in the PanMHC-PARCE protocol, can be adapted to identify MnhE2 variants with improved expression characteristics .

How can structural studies of MnhE2 inform functional understanding?

Structural characterization of MnhE2 can be approached through:

  • X-ray crystallography (requires detergent screening and crystal optimization)

  • Cryo-electron microscopy (suitable for membrane protein complexes)

  • NMR spectroscopy (for dynamic studies of specific domains)

  • Molecular dynamics simulations to model conformational changes

When interpreting structural data, correlate findings with functional assays to establish structure-function relationships. This approach is similar to the molecular dynamics-based methods used for MHC Class II epitope engineering, where structural analysis informed functional improvements . Structural insights can reveal ion coordination sites, conformational changes during transport cycles, and interaction interfaces with other subunits of the antiporter complex. These studies require careful experimental design to ensure that the structural data obtained is representative of the protein's native state and not artifacts of the experimental conditions .

What computational approaches can predict MnhE2 function and interactions?

Advanced computational methods to study MnhE2 include:

  • Homology modeling based on related antiporter structures

  • Molecular dynamics simulations of membrane-embedded MnhE2

  • Docking studies to identify potential inhibitors or substrates

  • Conservation analysis to identify functionally important residues

These computational approaches should be validated with experimental data whenever possible. Similar to the PanMHC-PARCE protocol used for MHC Class II epitope engineering, integration of computational modeling with experimental validation can provide powerful insights . When analyzing sequence data, transcriptomic approaches similar to those used for Staphylococcus xylosus can reveal how MnhE2 expression changes under different environmental conditions . This integrated approach combining computational prediction with experimental validation provides a robust framework for understanding MnhE2 function.

How can I study MnhE2 interaction with other antiporter subunits?

To investigate protein-protein interactions involving MnhE2:

  • Co-immunoprecipitation with tagged versions of different subunits

  • Bacterial two-hybrid or split-GFP complementation assays

  • Chemical cross-linking followed by mass spectrometry

  • FRET-based approaches for live-cell interaction studies

What approaches can determine the ion selectivity of MnhE2?

To characterize ion selectivity of MnhE2, implement:

  • Ion flux assays using radioactive tracers (²²Na⁺, ⁴⁵Ca²⁺)

  • Competitive inhibition studies with various cations

  • Patch-clamp electrophysiology with defined ion gradients

  • Mutagenesis of putative ion coordination sites

Results from these approaches should be analyzed according to rigorous experimental design principles, with appropriate controls and statistical analysis . Ion selectivity studies require careful consideration of experimental conditions, including pH, temperature, and the presence of other ions that might compete for transport. Similar methodological approaches have been used to study membrane potential changes in bacterial systems responding to environmental stressors . Integration of multiple experimental approaches provides the most comprehensive understanding of ion selectivity profiles.

How can transcriptomic analysis inform MnhE2 research?

Transcriptomic approaches for studying MnhE2 include:

  • RNA-Seq analysis to identify co-expressed genes under various conditions

  • qPCR validation of expression patterns

  • Promoter analysis to identify regulatory elements

  • Cross-species comparison of expression patterns

When implementing transcriptomic studies, follow the methodological approaches used in the Staphylococcus xylosus study, which identified differentially expressed genes in response to environmental conditions . Proper experimental design is crucial, including biological replicates and appropriate normalization methods . Analysis of transcriptomic data can reveal regulatory networks controlling MnhE2 expression and identify conditions where the protein plays critical roles. This can guide functional studies by suggesting physiologically relevant conditions for investigation.

How can I address protein aggregation during MnhE2 purification?

To overcome MnhE2 aggregation challenges:

  • Screen additional detergents (including novel amphipols and SMALPs)

  • Add stabilizing agents (glycerol, specific lipids, osmolytes)

  • Implement on-column detergent exchange

  • Consider nanodiscs or liposome reconstitution immediately after purification

These approaches address the hydrophobic nature of membrane proteins that often leads to aggregation. When optimizing purification protocols, systematically test variables using principles of good experimental design . Monitor protein quality using techniques like size-exclusion chromatography and dynamic light scattering. The stability of membrane proteins can be significantly influenced by their lipid environment, so incorporating specific lipids during purification may preserve native protein conformation and reduce aggregation.

What strategies help resolve conflicting data in MnhE2 functional studies?

When faced with contradictory results in MnhE2 research:

  • Verify protein integrity and activity using multiple independent assays

  • Systematically test environmental variables (pH, temperature, ion concentration)

  • Compare results using different expression systems and purification methods

  • Implement computational modeling to generate testable hypotheses

Resolution of conflicting data requires careful experimental design with appropriate controls and statistical analysis . Consider how experimental conditions might affect membrane protein function, including detergent effects and lipid composition. Approaches similar to those used in the molecular dynamics-based evolution protocol for MHC Class II epitopes can help reconcile conflicting data by providing structural insights into functional mechanisms . Integration of multiple experimental approaches often provides complementary data that can resolve apparent contradictions.

How can I determine if MnhE2 mutations affect protein stability versus function?

To distinguish between stability and functional effects of mutations:

  • Compare expression levels and solubility of wild-type and mutant proteins

  • Perform thermal or chemical denaturation assays to measure stability differences

  • Conduct activity assays under permissive conditions that compensate for stability issues

  • Use computational modeling to predict structural impacts of mutations

This combined approach can reveal whether mutations primarily affect protein folding/stability or directly impact functional sites. Similar methodological approaches have been used in the PanMHC-PARCE protocol to engineer improved epitopes . When designing mutagenesis experiments, follow established experimental design principles to ensure reliable and reproducible results . Correlation between stability measurements and functional assays can provide insights into the relationship between protein structure and function in MnhE2.

How can MnhE2 research contribute to antimicrobial development?

MnhE2 research has potential applications in antimicrobial discovery:

  • Target-based screening for specific inhibitors of MnhE2 function

  • Structure-based drug design leveraging unique features of bacterial antiporters

  • Combination approaches targeting multiple components of ion homeostasis

  • Development of membrane-disrupting agents that exploit MnhE2 function

These approaches draw on principles observed in studies of membrane depolarization induced by cell wall-targeting antibiotics . When designing screening assays, implement good experimental design principles to maximize the likelihood of identifying true hits . Understanding how MnhE2 contributes to bacterial survival under stress conditions, similar to what has been observed in Staphylococcus xylosus under nitrate/nitrite stress , can reveal vulnerabilities that might be exploited for antimicrobial development. This research direction has significant potential for addressing antibiotic resistance challenges.

What novel techniques are emerging for studying membrane proteins like MnhE2?

Cutting-edge approaches for membrane protein research include:

  • Single-molecule fluorescence microscopy for real-time transport studies

  • Cryo-electron tomography for in situ structural analysis

  • Advanced computational methods integrating molecular dynamics with machine learning

  • Microfluidic platforms for high-throughput functional characterization

These emerging techniques offer new opportunities to overcome traditional challenges in membrane protein research. Implementation of these approaches should follow established experimental design principles to ensure reliable results . As demonstrated in the molecular dynamics-based evolution protocol for MHC Class II epitopes, integration of computational and experimental approaches can provide powerful insights into protein function . These novel techniques may reveal previously inaccessible aspects of MnhE2 structure, dynamics, and function.

How can systems biology approaches enhance understanding of MnhE2 in cellular context?

Systems-level investigation of MnhE2 can include:

  • Integrative analysis of transcriptomic, proteomic, and metabolomic data

  • Network modeling to identify regulatory interactions

  • Synthetic biology approaches to reconstruct minimal systems

  • Comparative genomics across species to identify evolutionary patterns

These approaches provide a broader context for understanding MnhE2 function within cellular networks. When designing systems biology studies, follow established experimental design principles to ensure robust and reproducible results . Similar approaches have been used to study transcriptomic responses in Staphylococcus xylosus, revealing how environmental conditions affect expression patterns . Integration of data from multiple omics approaches can provide a comprehensive understanding of how MnhE2 contributes to cellular physiology under different conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.