Recombinant Putative antiporter subunit mnhF2 (mnhF2)

Shipped with Ice Packs
In Stock

Description

Physiological Functions

ProcessMechanismRole of mnhF2
pH HomeostasisNeutralizes cytoplasmic alkalinity via H⁺ efflux and Na⁺/K⁺ influx .Stabilizes subunit interactions in the complex .
OsmoregulationMaintains cellular turgor under high external Na⁺ or K⁺ concentrations .Facilitates ion transport through the antiporter .
PathogenesisContributes to S. aureus survival in host environments .Supports membrane potential for metabolic processes .

Ion Transport Mechanism

The Mnh complex operates as a secondary transporter, coupling ion gradients to proton motive force (PMF). Proposed models suggest:

  1. MrpA-MrpD Interface: Na⁺ transport occurs via conserved glutamic acid residues in MrpA and MrpD, while H⁺ is translocated through separate pathways .

  2. mnhF2-Specific Role: Likely involved in subunit assembly or stabilization, as mutations in homologous subunits (e.g., MrpF) reduce antiport activity .

Critical Research Findings

  1. Subunit Dependency: Deletion of mnhF2 homologs (e.g., MrpF) abolishes Na⁺/H⁺ antiport activity in E. coli models .

  2. pH Optima: Mnh complexes exhibit optimal activity at pH 7.5–9.0, with mnhF2-containing complexes (e.g., Mnh2) showing broader cation specificity (Na⁺/K⁺) .

  3. Structural Homology: mnhF2 shares homology with MrpF subunits in Bacillus spp., where mutations in charged residues (e.g., MrpF-D32A) disrupt ion transport .

Experimental Uses

  • Ion Transport Studies: Reconstituted into proteoliposomes to analyze Na⁺/H⁺ or K⁺/H⁺ exchange kinetics .

  • Drug Resistance: Investigated as a target for antimicrobials in S. aureus .

  • Structural Biology: Used in cryo-EM or X-ray crystallography to elucidate antiporter architecture .

Pathogenic Relevance

  • Viral Pathogenesis: Overexpression linked to S. aureus survival in host cells under stress .

  • Antimicrobial Therapy: Inhibition of mnhF2-containing complexes may enhance susceptibility to pH-sensitive antibiotics .

Challenges and Future Directions

  1. Mechanistic Gaps: Direct evidence for mnhF2’s role in ion translocation remains limited. Mutagenesis studies are needed to map functional residues .

  2. Dynamic Interactions: Real-time imaging of mnhF2 in Mnh complexes could clarify its role in subunit assembly .

  3. Therapeutic Potential: High-throughput screening for inhibitors targeting mnhF2 or its interactions with other subunits .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If dry ice shipping is required, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a preferred tag type, please inform us, and we will prioritize its development accordingly.
Synonyms
mnhF2; mrpF2; Putative antiporter subunit mnhF2; Mrp complex subunit F2; Putative NADH-ubiquinone oxidoreductase subunit mnhF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Staphylococcus aureus
Target Names
mnhF2
Target Protein Sequence
MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL
Uniprot No.

Target Background

Function
Expression of the mnh2 operon in E.coli does not demonstrate the ability to catalyze Na(+)Li(+)/H(+) antiport. However, it does confer increased growth rates compared to the control strain at pH levels up to 9.5. The operon may encode an NADH-ubiquinone oxidoreductase.
Protein Families
CPA3 antiporters (TC 2.A.63) subunit F family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of mnhF2 within the Mnh2 antiporter complex?

The mnhF2 subunit is one of the seven hydrophobic membrane-bound protein subunits that form the Mnh2 antiporter complex in Staphylococcus aureus. Similar to other bacterial cation/proton antiporters, the Mnh2 complex functions primarily in pH homeostasis and ion transport across the cell membrane. The structure features multiple transmembrane domains that facilitate cation exchange with protons across the membrane. While specific structural details of mnhF2 remain under investigation, research indicates it is functionally analogous to the MrpF subunit in related Mrp antiporter systems, with conserved regions essential for proper complex formation and function . Within the Mnh2 complex, mnhF2 likely contributes to the broader functional capacity of Mnh2 to exchange both sodium and potassium ions with protons, particularly at alkaline pH levels around 8.5 .

How does the Mnh2 antiporter complex differ from Mnh1 in ion specificity and pH dependence?

Experimental studies reveal distinct functional differences between the Mnh1 and Mnh2 antiporter complexes:

ParameterMnh1 AntiporterMnh2 Antiporter
Primary ion specificityNa+/H+ exchangeBoth Na+/H+ and K+/H+ exchange
Optimal pH activitypH 7.5pH 8.5
Growth impact upon deletionSignificant reduction in pH 7.5-9.0 rangeSignificant reduction in pH 8.5-9.5 range
Virulence impact upon deletionMajor loss of virulence in mouse modelsNo significant change in virulence

The Mnh1 antiporter demonstrates significant Na+/H+ exchange activity primarily at pH 7.5, functioning as a more specialized sodium antiporter. In contrast, the Mnh2 complex containing mnhF2 exhibits broader substrate specificity, efficiently exchanging both Na+/H+ and K+/H+ cations, with particularly strong activity at pH 8.5 . This suggests that mnhF2 may contribute to this broader ion specificity, potentially playing a role in potassium transport that distinguishes Mnh2 from Mnh1.

What are the standard methods for recombinant expression and purification of mnhF2?

Recombinant expression of mnhF2 typically employs strategies similar to those used for other membrane proteins, with modifications to address the challenges of expressing hydrophobic membrane proteins:

  • Expression System Selection: E. coli is commonly used, particularly antiporter-deficient strains like KNabc E. coli that allow for functional complementation studies .

  • Vector Design: Cloning into vectors like pGEM3Z+ with appropriate promoters for controlled expression in the selected host system .

  • Purification Protocol:

    • Membrane fraction isolation through differential centrifugation

    • Solubilization using appropriate detergents (often mild non-ionic detergents)

    • Affinity chromatography using poly-histidine tags

    • Size exclusion chromatography for final purification and assessment of complex formation

  • Activity Assessment: Preparation of everted (inside-out) membrane vesicles to measure ion transport activity through spectrophotometric or fluorescence-based assays that monitor pH changes or ion movement .

When working with mnhF2, researchers must carefully optimize expression conditions to prevent protein aggregation and ensure proper membrane integration, as hydrophobic membrane proteins often require lower expression temperatures and specialized induction protocols.

How can researchers evaluate the functional activity of recombinant mnhF2?

Functional assessment of recombinant mnhF2 requires techniques that can measure its contribution to antiporter activity:

  • Complementation Assays: Expression of mnhF2 in antiporter-deficient bacterial strains to assess restoration of growth under salt stress or alkaline conditions .

  • Everted Vesicle Assays: The most direct method for measuring antiporter activity involves preparing inside-out membrane vesicles containing the expressed protein and measuring proton movement in response to added cations (Na+ or K+). These assays typically employ pH-sensitive fluorescent dyes or acridine orange quenching measurements .

  • Growth Studies: Comparative growth analysis under varying pH and salt concentrations can indirectly assess mnhF2 function, particularly when comparing wild-type and mnhF2-mutant strains .

  • Blue Native PAGE Analysis: This technique helps evaluate whether mnhF2 properly incorporates into the Mnh2 complex, as proper complex formation is essential for antiporter function .

What mutations in mnhF2 affect complex formation versus antiporter activity?

Based on studies of homologous systems, mutations in antiporter subunits can be categorized by their effects on complex formation and activity:

Mutation CategoryEffect on Complex FormationEffect on ActivityExample Residues in Related Antiporters
Category 1Disrupts complex formationNo activityMutations affecting transmembrane helices
Category 2Prevents monomer formationPartial activity retentionSimilar to MrpB-P37G, MrpC-Q70A mutations
Category 3Complex forms correctlyComplete loss of activityConserved charged residues (E, K) in transmembrane regions
Category 4Complex forms correctlyReduced activity (~30% of wild-type)Similar to MrpC-G82I and MrpF-R33A mutations
Category 5Complex forms correctlyAltered ion affinityConserved histidine residues

Research suggests that mutations in mnhF2 likely follow similar patterns to those observed in MrpF, where conserved arginine residues (such as R33 in MrpF) can significantly impact antiporter activity without preventing complex formation . To properly characterize mnhF2 mutations, researchers should employ both Blue Native PAGE to assess complex formation and functional assays to measure antiporter activity with varying ion concentrations.

How does mnhF2 contribute to the pH homeostasis mechanism in Staphylococcus aureus?

The Mnh2 antiporter complex containing mnhF2 plays a crucial role in pH homeostasis, particularly at alkaline pH levels (8.5-9.5) . The precise contribution of mnhF2 can be investigated through:

  • pH-Dependent Growth Studies: Comparing growth patterns of wild-type, mnhF2 deletion mutants, and complemented strains across pH gradients.

  • Internal pH Measurement: Using pH-sensitive fluorescent probes to monitor cytoplasmic pH in response to external pH shifts.

  • Ion Dependency Analysis: Determining how the presence of different cations (Na+, K+) affects the ability of mnhF2-containing complexes to maintain internal pH.

Research on the Mnh2 complex indicates it contributes significantly to alkaline pH tolerance, with deletion of the mnhA2 gene (another component of the Mnh2 complex) resulting in growth defects primarily in the pH range of 8.5 to 9.5 . The mnhF2 subunit likely participates in this pH homeostasis mechanism through its contribution to K+/H+ exchange capability, which becomes particularly important at higher pH values where proton availability is limited.

What experimental approaches can distinguish between sodium and potassium transport functions of mnhF2?

To differentiate between Na+/H+ and K+/H+ antiport functions potentially mediated by mnhF2, researchers can employ several specialized techniques:

  • Ion-Specific Transport Assays: Using everted membrane vesicles containing recombinant mnhF2 or the complete Mnh2 complex, researchers can measure transport activity separately with Na+ or K+ as substrates at different pH values. This allows quantification of the relative contribution to each ion's transport .

  • Site-Directed Mutagenesis: Targeted mutation of specific residues in mnhF2 can help identify amino acids specifically involved in K+ binding versus Na+ binding. Comparative analysis of these mutants can reveal ion-specific functional domains.

  • Competition Assays: Measuring antiport activity in the presence of both ions at varying concentrations can reveal preference and potential binding site competition.

  • Electrophysiological Studies: Patch-clamp techniques applied to proteoliposomes containing purified recombinant mnhF2 can provide direct measurements of ion currents with high specificity.

Data from the Mnh2 complex indicates it functions efficiently in K+/H+ exchange, particularly at pH 8.5, distinguishing it from the Mnh1 complex which primarily mediates Na+/H+ exchange at pH 7.5 . Researchers should design experiments that specifically isolate the contribution of mnhF2 to this broader ion specificity.

How does the structure-function relationship of mnhF2 compare to other antiporter subunits?

Understanding the structure-function relationship of mnhF2 requires comparative analysis with other antiporter subunits:

  • Sequence Homology Analysis: Alignment of mnhF2 with homologous subunits such as MrpF reveals conserved motifs potentially crucial for function. Studies of MrpF have identified that conserved arginine residues (e.g., R33) are critical for antiport activity .

  • Transmembrane Topology Mapping: Techniques such as cysteine scanning mutagenesis can map the transmembrane regions of mnhF2 and identify structurally important domains.

  • Cross-linking Studies: Chemical cross-linking paired with mass spectrometry can identify interaction interfaces between mnhF2 and other subunits in the complex.

  • Evolutionary Conservation Analysis: Comparing mnhF2 sequences across diverse bacterial species can highlight universally conserved regions likely essential for function.

Research on related antiporter subunits suggests that the F subunits in these complexes may play roles in ion selectivity and protein-protein interactions necessary for complex assembly . The mnhF2 subunit likely shares these functions, particularly contributing to the K+/H+ exchange capability that distinguishes Mnh2 from Mnh1.

What role does mnhF2 play in Staphylococcus aureus virulence and pathogenicity?

  • Tissue-Specific Infection Models: Different host tissues present varying pH and ion conditions, potentially revealing context-dependent roles for mnhF2 in specific infection sites.

  • Immune Evasion Mechanisms: Intracellular survival within phagocytes often requires adaptation to variable pH environments, where mnhF2's role in pH homeostasis may contribute to bacterial persistence.

  • Biofilm Formation Assessment: Evaluating how mnhF2 deletion affects biofilm development and structure under varying pH and salt conditions.

  • Transcriptomic Analysis: RNA-seq comparing wild-type and mnhF2 deletion mutants under infection-mimicking conditions can reveal coordinated gene expression changes that may contribute to virulence.

The difference in virulence impact between Mnh1 and Mnh2 deletion (with Mnh1 deletion causing major virulence loss while Mnh2 deletion does not) suggests potential functional redundancy or context-dependent importance of the Mnh2 complex containing mnhF2. Researchers should design experiments that specifically interrogate conditions where Mnh2 function might become critical for bacterial survival during infection.

What are the challenges and solutions for obtaining functional recombinant mnhF2?

Obtaining functional recombinant mnhF2 presents several technical challenges:

ChallengeTechnical SolutionMethodological Approach
Hydrophobicity causing aggregationOptimization of detergentsScreening multiple detergents (DDM, LMNG, etc.) for solubilization
Low expression levelsExpression tag optimizationTesting various fusion partners (MBP, SUMO) to enhance solubility
Functional assessmentComplementation systemsUsing antiporter-deficient bacterial strains for functional screening
Isolation of individual subunit functionReconstitution strategiesProteoliposome reconstitution with purified components
Complex assembly requirementsCo-expression systemsSimultaneous expression of multiple Mnh2 complex subunits

Researchers should consider that mnhF2 may require the presence of other Mnh2 complex subunits for proper folding and function. The most successful approaches typically involve either co-expression of multiple subunits or expression in systems that already contain complementary components. For functional assessment, everted vesicle preparations have proven effective for measuring antiporter activity of recombinant proteins .

How can researchers design experiments to study mnhF2's specific contribution to antiporter function?

  • Selective Gene Deletion and Complementation: Create mnhF2 deletion strains followed by complementation with wild-type or mutant mnhF2 variants, assessing specific functional parameters.

  • Chimeric Protein Construction: Engineer hybrid proteins swapping domains between mnhF2 and homologous subunits (like mnhF1 from Mnh1) to identify regions responsible for specific functions.

  • Dominant Negative Approaches: Express mutant forms of mnhF2 in wild-type backgrounds to disrupt specific functions while maintaining complex formation.

  • Single-Molecule Techniques: Employ methods such as single-molecule FRET to study conformational changes in mnhF2 during transport cycles.

  • Specialized Expression Systems: Use controlled expression systems where mnhF2 levels can be precisely regulated to study dose-dependent effects on complex formation and function.

Experimental design should account for the complexity of studying a single subunit within a seven-subunit complex. Quantitative approaches that can differentiate between effects on complex assembly versus direct effects on transport activity are particularly valuable .

What computational approaches support research on mnhF2 structure and function?

Computational methods provide valuable insights into mnhF2 research:

  • Homology Modeling: Using structures of related antiporter subunits as templates to predict mnhF2 structure. Recent advances in protein structure prediction tools like AlphaFold can provide reasonably accurate models despite low sequence identity.

  • Molecular Dynamics Simulations: Simulating mnhF2 behavior within a lipid bilayer environment to predict ion binding sites and conformational changes during transport cycles.

  • Evolutionary Coupling Analysis: Identifying co-evolving residues that may represent functionally important interaction networks within mnhF2 or between mnhF2 and other subunits.

  • Binding Site Prediction: Computational tools can predict potential ion binding sites based on electrostatic potential mapping and conservation analysis.

  • Systems Biology Approaches: Integration of transcriptomic, proteomic, and metabolomic data to understand mnhF2 regulation and function in the broader context of cellular physiology.

These computational approaches are particularly valuable for membrane proteins like mnhF2 where experimental structural determination remains challenging. Predictions derived from computational models can guide experimental design, particularly for site-directed mutagenesis studies targeting functionally important residues .

How does environmental adaptation drive evolutionary conservation of mnhF2?

The evolutionary conservation of mnhF2 across bacterial species reflects its importance in environmental adaptation:

  • Phylogenetic Analysis: Comparative genomic studies reveal that antiporter subunits similar to mnhF2 are widely distributed across diverse bacterial phyla, suggesting fundamental roles in cellular physiology.

  • Environmental Niche Correlation: Bacteria from extreme environments (high pH, high salt) often show expanded families of antiporter genes with specialized functions.

  • Horizontal Gene Transfer Patterns: Analysis of genomic context and codon usage can reveal instances of horizontal acquisition of mnhF2-like genes in response to environmental pressures.

Research on related antiporter systems indicates that these complexes play crucial roles in bacterial adaptation to environmental stress, particularly pH extremes and high salt conditions . The specific contribution of mnhF2 to potassium transport capability may represent an adaptation to environments where potassium availability fluctuates or where potassium accumulation provides adaptive advantages.

What are the emerging technologies advancing research on antiporter subunits like mnhF2?

The field of antiporter research continues to advance through new technologies:

  • Cryo-Electron Microscopy: High-resolution structural determination of complete antiporter complexes is becoming increasingly feasible, potentially revealing the precise structural arrangement of mnhF2 within the Mnh2 complex.

  • Native Mass Spectrometry: This technique can determine subunit stoichiometry and stability of membrane protein complexes like Mnh2 under near-native conditions.

  • In-Cell NMR: Emerging methods for structural analysis of membrane proteins within living cells may provide insights into the dynamic behavior of mnhF2 in its native environment.

  • CRISPR-Based Technologies: Precise genome editing techniques enable sophisticated genetic manipulations to study mnhF2 function in various contexts.

  • Single-Vesicle Transport Assays: Advanced microfluidic systems paired with fluorescent sensors can measure transport activity at the single-vesicle level, providing unprecedented resolution of transport kinetics.

These technologies are expanding researchers' ability to study challenging membrane protein complexes like Mnh2 and its constituent subunits, including mnhF2, potentially revealing new aspects of structure-function relationships that were previously inaccessible .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.