Recombinant Putative antiporter subunit mnhG2 (mnhG2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
mnhG2; mrpG2; Putative antiporter subunit mnhG2; Mrp complex subunit G2; Putative NADH-ubiquinone oxidoreductase subunit mnhF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Staphylococcus aureus
Target Names
mnhG2
Target Protein Sequence
MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLI YFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNE QNSTEALQLRAEKREEHRKKWYQND
Uniprot No.

Target Background

Function

In E. coli, expression of the mnh2 operon does not catalyze Na+Li+/H+ antiport. However, it does enhance growth rates compared to control strains at pH levels up to 9.5. The operon may encode an NADH-ubiquinone oxidoreductase.

Protein Families
CPA3 antiporters (TC 2.A.63) subunit G family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of MnhG2 within the Mnh2 antiporter complex?

MnhG2 functions as one of seven hydrophobic membrane-bound protein subunits that collectively form the Mnh2 antiporter complex in S. aureus. The complete Mnh2 antiporter consists of subunits MnhA2 through MnhG2, encoded by the mnh2 operon. Unlike the mnh1 operon that consists solely of seven mnh1 genes, the mnh2 operon includes an integrase-recombinase gene (itr) preceding the seven mnh2 genes . This structural arrangement is significant for understanding the evolutionary relationship between Mnh antiporters and other membrane transport systems.

The transmembrane topology of MnhG2, like other Mrp/Mnh subunits, has been predicted using computational tools such as ConPred II, HMMTOP, and TMHMM. These analyses help identify critical functional domains and potential mutation sites that affect complex formation and ion transport activity .

What expression patterns does MnhG2 exhibit under different environmental conditions?

The expression of the mnh2 operon, including the mnhG2 gene, differs significantly from that of the mnh1 operon. While Mnh1 expression appears to be largely constitutive, the Mnh2 antiporter is induced by the sigma factor σᴮ . This regulatory difference suggests distinct physiological roles for the two antiporter systems.

Microarray-based gene expression experiments have shown that Mnh2 subunits, including MnhG2, are upregulated under specific stress conditions, particularly at alkaline pH. This corresponds with the finding that Mnh2 exhibits optimal antiport activity at pH 9.0, compared to Mnh1's optimum at pH 7.5 . This expression pattern aligns with Mnh2's role in bacterial adaptation to alkaline environments.

What methodologies are most effective for expressing and purifying recombinant MnhG2 for structural studies?

To express and purify recombinant MnhG2 for structural studies, researchers should consider the following methodological approach:

  • Expression system selection: Due to the hydrophobic, membrane-bound nature of MnhG2, specialized expression systems are required. The E. coli KNabc strain (with deletions in major Na⁺/H⁺ antiporter genes nhaA, nhaB, and chaA) has been successfully used for expression of Mrp/Mnh subunits, providing both a suitable expression platform and a functional complementation assay .

  • Vector design: Incorporate affinity tags (such as His₆ or FLAG) at either the N- or C-terminus of MnhG2, avoiding disruption of transmembrane domains. Include a cleavage site for tag removal if needed for structural studies.

  • Membrane protein solubilization: Use mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) for extraction from membranes while maintaining protein integrity.

  • Purification strategy: Employ affinity chromatography followed by size exclusion chromatography to obtain pure protein. For structural studies, consider purifying the entire Mnh2 complex, as MnhG2 alone may not maintain its native conformation.

  • Functional validation: Confirm activity of the purified protein through reconstitution in liposomes and measurement of ion transport activities using fluorescent probes or radioisotopes.

For researchers specifically interested in protein-protein interactions within the complex, Blue Native PAGE (BN-PAGE) analysis has proven valuable in assessing complex formation, as demonstrated in studies of the homologous Mrp system .

How do mutations in MnhG2 affect the assembly and function of the Mnh2 antiporter complex?

Studies on homologous Mrp systems provide valuable insights into how mutations in MnhG2 might affect the Mnh2 complex. Based on research with the Bacillus pseudofirmus OF4 Mrp antiporter, mutations in MrpG can result in several distinct phenotypes, categorized based on their effects on complex formation and activity.

Table 1: Potential Effects of MnhG2 Mutations Based on Homologous MrpG Studies

CategoryEffect on ComplexEffect on ActivityRepresentative MrpG Mutation
1Disrupts complex formationComplete loss of activityMrpG-P81 variants
2Affects interaction with other subunitsRetains some activity-
3Complex forms normallyComplete loss of activity-
4Complex forms normallyPartial decrease (~70%)-
5Complex forms normallyAltered Km for ions-

The unique phenotype observed with MrpG-P81 mutations suggests this residue may be particularly critical for the proper folding and assembly of the G subunit within the complex . By extension, the corresponding residue in MnhG2 likely plays a similar role.

Researchers investigating MnhG2 mutations should employ site-directed mutagenesis targeting conserved residues, followed by expression in complementation systems like the E. coli KNabc strain. Functional assessment should include both growth complementation under various salt stress conditions and direct measurement of antiport activities using everted membrane vesicles or reconstituted proteoliposomes .

What is the physiological role of MnhG2 in bacterial stress response and virulence?

The Mnh2 antiporter, including the MnhG2 subunit, contributes significantly to both osmotolerance and halotolerance in S. aureus. This is particularly evident at high cytoplasmic potassium concentrations (approximately 900 mM), where Mnh2 maintains K⁺/H⁺ antiport activity while Mnh1 becomes inactive . This functional specialization suggests MnhG2 contributes to bacterial survival under specific stress conditions.

Researchers investigating the physiological role of MnhG2 should consider:

  • Creating precise mnhG2 deletion mutants using CRISPR-Cas9 or allelic exchange methodologies

  • Performing growth curve analyses under various stress conditions (pH, salt concentrations, osmotic stress)

  • Conducting transcriptomic and proteomic analyses to identify compensatory responses

  • Using fluorescent pH indicators to measure intracellular pH homeostasis

  • Employing ion-specific fluorescent probes to monitor Na⁺ and K⁺ transport in vivo

These approaches will provide a comprehensive understanding of MnhG2's contribution to bacterial physiology beyond simple growth phenotypes.

How does the ion transport mechanism of the Mnh2 complex incorporating MnhG2 compare to other antiporter systems?

The ion transport mechanism of the Mnh2 antiporter complex, including the role of MnhG2, shares similarities with other multisubunit antiporters but possesses unique characteristics. Two models have been proposed for ion transport through Mrp/Mnh antiporters:

  • Dual pathway model: Proposes that MrpA/MnhA2 subunits transport Na⁺ while MrpD/MnhD2 subunits transport H⁺ in the opposite direction, resulting in antiport activity .

  • Interface pathway model: Suggests that each MrpA/MnhA2 and MrpD/MnhD2 subunit contains a H⁺ pathway, while the interface between these subunits forms a Na⁺ transport pathway .

While these models focus primarily on the A and D subunits, the other subunits, including MnhG2, are believed to play supporting roles in maintaining the proper structure of the complex and potentially modulating the transport activity.

The Mnh2 antiporter shows homology to respiratory chain complex I components, particularly in the A and D subunits. Conserved glutamic acid and lysine residues form what appears to be the core of the proton transport pathway, based on crystal structure analyses of homologous proteins . The small subunits like MnhG2 may contribute to ion selectivity or regulate transport rates through protein-protein interactions.

Researchers studying the transport mechanism should consider:

  • Using site-directed fluorescence labeling to track conformational changes during transport

  • Employing electrophysiological techniques with reconstituted proteoliposomes

  • Developing computational models based on available structural data

  • Performing cross-linking studies to map the interaction interfaces between subunits

What are the most effective experimental approaches to study the interaction between MnhG2 and other subunits of the Mnh2 complex?

To effectively study the interactions between MnhG2 and other subunits of the Mnh2 complex, researchers should consider a multi-faceted approach:

  • Blue Native PAGE (BN-PAGE): This technique has proven valuable for analyzing intact membrane protein complexes. Studies of the homologous Mrp system demonstrated that BN-PAGE can detect both the monomeric and dimeric forms of the complex and identify mutations that disrupt complex formation .

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometric analysis can map interaction interfaces between MnhG2 and adjacent subunits. Zero-length cross-linkers like EDC (1-ethyl-3-(3-dimethylaminopropyl)carbodiimide) are particularly useful for identifying residues in direct contact.

  • Co-immunoprecipitation with tagged subunits: Expressing MnhG2 with an affinity tag allows for pull-down experiments to identify interacting partners. Alternatively, antibodies against MnhG2 can be used to co-immunoprecipitate the entire complex.

  • Bacterial two-hybrid system: Modified for membrane proteins, this approach can detect binary interactions between MnhG2 and other subunits in a cellular context.

  • Förster resonance energy transfer (FRET): By labeling MnhG2 and potential interaction partners with appropriate fluorophores, FRET can detect proximity in the nanometer range, confirming direct interactions.

Based on studies of the homologous Mrp system, certain mutations in specific subunits can affect the interaction between subunit groups. For example, mutations in MrpA-P677G, MrpB-P37G, and MrpC-Q70A retained Na⁺/H⁺ antiport activity but failed to show formation of the Mrp complex monomer in BN-PAGE analysis . These mutations were proposed to destabilize interactions between the MrpABCD subcomplex and the MrpE, MrpF, and MrpG subunits. Similar approaches could be applied to study MnhG2 interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.