Recombinant Putative calcium-binding mitochondrial carrier F55A11.4 (F55A11.4)

Shipped with Ice Packs
In Stock

Description

Calcium-Dependent Regulation

Mitochondrial carriers like F55A11.4 are modulated by calcium via EF-hand domains. Mechanistic insights from homologous proteins reveal:

  • Activation: Calcium binding induces conformational changes, enabling substrate transport through the carrier domain .

  • Inhibition: Calcium depletion releases the amphipathic α-helix, which blocks the carrier domain in a "locked" state .

  • Calcium Sensitivity: Half-maximal activation (EC₅₀) for human homologs occurs at ~179 μM free calcium, aligning with cytosolic signaling ranges .

Vaccine Development

  • F55A11.4 is marketed as a vaccine ingredient for preclinical studies, though not approved for human/animal use .

Mitochondrial Transport Studies

  • Substrate Specificity: Likely transports adenine nucleotides or phosphate, akin to ATP-Mg/Pi carriers (APCs) in humans .

  • Functional Analogues: Shares structural homology with human SLC25A12 (Aralar1), a calcium-regulated aspartate/glutamate carrier .

FeatureF55A11.4Human APC1
Calcium-Binding DomainsPutative EF-hands (N-terminal)4 EF-hands (N-terminal)
Transport MechanismLocking pin via amphipathic α-helix Calcium-dependent substrate translocation
SubstratesPutative adenine nucleotides/phosphateATP-Mg²⁺, phosphate

Production and Quality Control

  • Expression Systems: Optimized in E. coli for high yield and solubility .

  • Purification: Affinity chromatography using His tags, followed by buffer exchange to remove contaminants .

  • Validation: Activity assays (e.g., ATP uptake) confirm calcium-dependent functionality in reconstituted liposomes .

Biological Relevance in C. elegans

  • Genetic Context: Part of C. elegans' 20,470 protein-coding genes, contributing to behaviors like chemotaxis and learning .

  • Mitochondrial Roles: Likely maintains matrix adenine nucleotide pools, impacting energy metabolism and stress responses .

Limitations and Future Directions

  • Functional Gaps: Direct substrate specificity and physiological roles in C. elegans remain unvalidated experimentally.

  • Therapeutic Potential: Structural insights could inform drug design for calcium-related mitochondrial disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Kindly consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
F55A11.4; Putative calcium-binding mitochondrial carrier F55A11.4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-588
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
F55A11.4
Target Protein Sequence
MINKNEQTESTSGAAEQKEDDEEQYVQLSSLGEYKDEVTPLLSPKHVPLVLGKVTKEAAI ATHSALHGGMSEEKERQIRDIYDRLDIDNDGTIDIRDLTLALKHETPHIPANLAPVIMSK MSPDDEGRVDFYSFSSYVLENEQKLAEMFADMDRNHDGLVDVVEMKNYCKDIGVPLDDHK AQHIVNKMDQTGSASVDLKEFQEFMMLYPSSDLKDIVDFWRHNLIIDIGEDSQIPEDFSQ QEMQEGIWWRHLVAGGAAGAVSRTCTAPFDRIKVYLQVNSSKTNRLGVMSCLKLLHAEGG IKSFWRGNGINVIKIAPESAIKFMCYDQLKRLIQKKKGNEEISTFERLCAGSAAGAISQS TIYPMEVMKTRLALRKTGQLDRGIIHFAHKMYTKEGIRCFYKGYLPNLIGIIPYAGIDLA IYETLKRTYVRYYETNSSEPGVLALLACGTCSSTCGQLSSYPFALVRTRLQALSITRYSP QPDTMFGQFKYILQNEGVTGFYRGITPNFLKVIPAVSISYVVYEKVRTGLGVPVCSRGGL EDIHQFLPCSIHSIIQFFFFPRTFLLTISGRSLRVKPVWRSHFSKFNK
Uniprot No.

Target Background

Function
Recombinant Putative calcium-binding mitochondrial carrier F55A11.4 (F55A11.4) is a mitochondrial and calcium-binding carrier protein that catalyzes the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the mitochondrial inner membrane.
Database Links

STRING: 6239.F55A11.4a

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is F55A11.4 and what is its functional role in C. elegans?

F55A11.4 is a putative calcium-binding mitochondrial carrier protein in Caenorhabditis elegans. It belongs to the mitochondrial carrier family and is predicted to be involved in calcium ion transport across the inner mitochondrial membrane. The protein contains characteristic calcium-binding domains and shares structural features with other mitochondrial carriers. While limited direct experimental data exists specifically for F55A11.4, related proteins in the F55A11 family have been identified in proteomic studies of C. elegans, with F55A11.3 being shown to interact with proteasomal components .

How does F55A11.4 differ from related mitochondrial carrier proteins?

F55A11.4 belongs to the mitochondrial carrier family but is distinguished by its calcium-binding domains. While traditional mitochondrial carriers transport metabolites and cofactors, calcium-binding carriers like F55A11.4 may have specialized regulatory functions related to calcium homeostasis. Structurally, F55A11.4 likely contains the characteristic six transmembrane domains found in mitochondrial carriers, but with additional calcium-binding motifs that could modulate its transport activity or specificity.

What expression patterns have been observed for F55A11.4 in C. elegans?

Expression profiling suggests that F55A11.4 is expressed in various tissues in C. elegans. While specific expression patterns for F55A11.4 are not directly mentioned in the search results, related F55 family proteins have been studied in different contexts. The presence of F55A11.4 across multiple tissues would be consistent with the ubiquitous importance of mitochondrial calcium handling. Detailed characterization using reporter constructs would be necessary to map its precise expression pattern across tissues and developmental stages.

What expression systems are most effective for producing recombinant F55A11.4?

For successful expression of recombinant F55A11.4, several expression systems can be considered:

  • Bacterial expression (E. coli):

    • BL21(DE3) strains with specialized vectors like pET series

    • C41/C43 strains specifically designed for membrane proteins

    • Lower induction temperatures (16-20°C) to enhance proper folding

  • Eukaryotic expression systems:

    • Yeast (S. cerevisiae or P. pastoris) for better membrane protein folding

    • Insect cell systems using baculovirus vectors

    • Mammalian cell lines for more native-like post-translational modifications

The choice depends on downstream applications, with bacterial systems offering higher yields but eukaryotic systems potentially providing better protein folding and functionality for this membrane protein.

What are the most effective genetic approaches to study F55A11.4 function in vivo?

Several genetic approaches can be employed to study F55A11.4 function:

  • CRISPR/Cas9 gene editing:

    • Generate precise deletions, insertions, or point mutations

    • Create reporter fusions (e.g., GFP) at the endogenous locus

    • Introduce conditional alleles for temporal control

  • RNAi knockdown:

    • Utilize feeding RNAi methods established for C. elegans

    • Design target sequences with minimal off-target effects

    • Use tissue-specific RNAi to distinguish cell-autonomous functions

  • Overexpression studies:

    • Express under tissue-specific promoters to assess gain-of-function effects

    • Use inducible promoters for temporal control

When designing these experiments, it's crucial to include appropriate controls and rescue experiments to confirm phenotype specificity. Experimental design should follow pre-experimental research principles where treatments are carefully controlled to establish cause-effect relationships .

What purification strategies yield functional F55A11.4 protein for biochemical studies?

Purifying functional F55A11.4 requires specialized approaches for membrane proteins:

  • Solubilization optimization:

    • Screen various detergents (DDM, LMNG, digitonin)

    • Test different detergent:protein ratios

    • Include stabilizing agents (glycerol, specific lipids)

  • Chromatography strategy:

    • Initial capture via affinity tag (His-tag, FLAG-tag)

    • Secondary purification by size exclusion chromatography

    • Consider ion exchange as a polishing step

  • Functional validation:

    • Verify calcium binding using spectroscopic methods

    • Assess oligomeric state by native PAGE or analytical ultracentrifugation

    • Confirm proper folding by circular dichroism

For downstream applications, reconstitution into proteoliposomes or nanodiscs may be necessary to study transport function in a membrane environment.

How does calcium binding regulate the transport activity of F55A11.4?

Understanding the relationship between calcium binding and transport function requires sophisticated approaches:

  • Structure-function analysis:

    • Generate mutations in predicted calcium-binding domains

    • Perform calcium binding assays with wild-type and mutant proteins

    • Correlate binding with transport activity

  • Conformational studies:

    • Use hydrogen-deuterium exchange mass spectrometry to detect conformational changes

    • Apply FRET-based sensors to monitor structural rearrangements

    • Consider structural biology approaches (X-ray crystallography, cryo-EM)

  • Electrophysiological approaches:

    • Reconstitute in planar lipid bilayers for direct transport measurements

    • Establish patch-clamp protocols if channel-like properties exist

    • Measure transport under varying calcium concentrations

These approaches can reveal whether calcium acts as a transported substrate, an allosteric regulator, or both for F55A11.4.

What role does F55A11.4 play in mitochondrial stress responses and quality control?

F55A11.4 may participate in mitochondrial stress responses and quality control mechanisms:

  • Stress-induced expression changes:

    • Analyze F55A11.4 expression under various stressors (oxidative, thermal, proteotoxic)

    • Determine if F55A11.4 is regulated by stress-responsive transcription factors

  • Interaction with quality control machinery:

    • Investigate potential interactions with the proteasome, similar to F55A11.3 which interacts with proteasome components

    • Examine connections to mitochondrial proteases and chaperones

  • Impact on mitochondrial homeostasis:

    • Assess mitochondrial morphology, membrane potential, and ROS production in F55A11.4 mutants

    • Measure calcium homeostasis during stress responses

Understanding these relationships could reveal novel connections between calcium signaling and mitochondrial quality control pathways, potentially similar to ER-associated degradation systems involving related proteins like F55A11.3 .

How does F55A11.4 function integrate with other calcium transport systems in mitochondria?

Mitochondria contain multiple calcium transport mechanisms that may work with F55A11.4:

  • Comparative analysis:

    • Assess calcium handling in various genetic backgrounds (F55A11.4 mutants, MCU mutants, NCLX mutants)

    • Determine if compensatory mechanisms exist between transport systems

  • Spatiotemporal regulation:

    • Visualize calcium dynamics using targeted calcium sensors

    • Determine if F55A11.4 operates in specialized mitochondrial domains

  • Metabolic integration:

    • Investigate how F55A11.4-mediated calcium transport affects TCA cycle activity

    • Measure ATP production and oxygen consumption in response to calcium signals

How should calcium transport data for F55A11.4 be analyzed and interpreted?

Proper analysis of calcium transport data requires rigorous approaches:

  • Kinetic parameter determination:

    • Calculate transport rates, Km, and Vmax values

    • Assess mode of transport (uniport, antiport, symport)

    • Determine pH and membrane potential dependence

  • Data presentation:

    • Use appropriate normalization (per protein, per vesicle)

    • Include statistical analyses for replicate experiments

    • Present raw traces alongside processed data

  • Interpretation framework:

    • Compare to known mitochondrial calcium transporters

    • Consider physiological calcium concentrations in different compartments

    • Interpret in the context of mitochondrial energetics

When analyzing data, researchers should apply sensitive computational methods similar to the generalized profile method used for identifying homology domains in vesicular fusion proteins . This allows detection of subtle functional relationships that might not be apparent with standard analysis.

What approaches can resolve contradictory findings in F55A11.4 research?

When facing contradictory results in F55A11.4 studies, systematic approaches include:

  • Methodological reconciliation:

    • Standardize experimental conditions and protocols

    • Directly compare different expression systems and purification methods

    • Validate key findings using complementary techniques

  • Genetic background effects:

    • Check for modifier genes in different C. elegans strains

    • Consider compensatory mechanisms in chronic vs. acute loss of function

    • Examine potential redundancy with related transporters

  • Context-dependent functions:

    • Investigate tissue-specific roles that might explain discrepancies

    • Consider developmental stage and environmental conditions

    • Examine protein interaction networks in different contexts

  • Integrative analysis:

    • Combine in vitro and in vivo approaches to build a comprehensive model

    • Use computational modeling to reconcile seemingly contradictory data

This systematic approach can often resolve apparent contradictions by revealing condition-specific functions of F55A11.4.

How can multi-omics data enhance our understanding of F55A11.4 function?

Multi-omics approaches provide comprehensive insights into F55A11.4 function:

  • Integrative strategies:

    • Combine transcriptomics, proteomics, and metabolomics data from F55A11.4 mutants

    • Analyze mitochondrial and whole-cell datasets in parallel

    • Apply pathway and network analyses to identify affected systems

  • Specialized methodologies:

    • Employ TMT-based proteomics for quantitative protein analysis, similar to approaches used in other C. elegans studies

    • Utilize targeted metabolomics to focus on calcium-dependent mitochondrial pathways

    • Apply interactomics to map the F55A11.4 protein-protein interaction network

  • Data integration frameworks:

    • Construct mathematical models of mitochondrial calcium handling

    • Identify regulatory hubs using network analysis

    • Apply machine learning for pattern recognition across datasets

Multi-omics approaches similar to those used in C. elegans sleep loss studies can reveal system-level effects of F55A11.4 dysfunction beyond its immediate transport function.

How can researchers overcome challenges in expressing and purifying functional F55A11.4?

Troubleshooting strategies for recombinant F55A11.4 expression include:

  • Expression optimization:

    • Screen multiple expression vectors and host strains

    • Test induction conditions (temperature, inducer concentration, time)

    • Consider codon optimization for the expression host

    • Use autoinduction media to avoid toxicity from sudden overexpression

  • Solubility enhancement:

    • Conduct detergent screens (start with mild detergents like DDM)

    • Add stabilizing lipids during extraction

    • Use fusion partners known to enhance membrane protein solubility

    • Consider nanodiscs or amphipols for detergent-free environments

  • Purification refinement:

    • Optimize buffer conditions (pH, ionic strength, additives)

    • Include protease inhibitors throughout the process

    • Minimize time between steps to prevent aggregation

    • Validate protein quality using size exclusion chromatography and activity assays

These approaches can help overcome the inherent challenges of working with membrane proteins like F55A11.4.

What controls are essential for validating F55A11.4 genetic studies in C. elegans?

Rigorous genetic studies require appropriate controls:

  • For CRISPR/Cas9 gene editing:

    • Sequence verification of the entire targeted locus

    • Analysis of predicted off-target sites

    • Creation of multiple independent alleles

    • Rescue experiments with wild-type F55A11.4

  • For RNAi experiments:

    • Non-targeting RNAi controls

    • Multiple non-overlapping RNAi constructs

    • qPCR validation of knockdown efficiency

    • Controls for RNAi efficiency (positive control RNAi)

  • For phenotypic analysis:

    • Blind scoring of phenotypes

    • Appropriate wild-type and background strain controls

    • Tissue-specific rescue experiments

    • Temperature and environmental condition controls

These controls ensure that observed phenotypes are specifically attributable to F55A11.4 function rather than experimental artifacts or off-target effects, following principles of true experimental research design that establish cause-effect relationships .

How can researchers distinguish between direct and indirect effects of F55A11.4 manipulation?

Distinguishing direct from indirect effects requires careful experimental design:

  • Acute vs. chronic manipulation:

    • Use rapid protein degradation systems (e.g., auxin-inducible degron)

    • Apply conditional alleles to observe immediate consequences

    • Compare acute effects with long-term adaptations

  • Tissue-specific approaches:

    • Utilize tissue-specific promoters for rescue or knockdown

    • Perform cell-autonomous vs. non-autonomous analysis

    • Isolate specific tissues for biochemical analysis

  • Primary vs. secondary effects:

    • Conduct time-course experiments to establish order of events

    • Use specific inhibitors to block potential downstream pathways

    • Perform epistasis experiments with related genes

  • Direct biochemical validation:

    • Reconstitute purified F55A11.4 in minimal systems to verify intrinsic activities

    • Use in vitro assays to confirm proposed mechanisms

    • Apply proteomics to identify direct binding partners

These approaches can help delineate the direct functions of F55A11.4 from secondary cellular responses to its manipulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.