Recombinant Putative cytochrome c-type biogenesis protein dbsD-like

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Putative cytochrome c-type biogenesis protein DbsD-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Pyropia yezoensis (Susabi-nori) (Porphyra yezoensis)
Target Protein Sequence
MKLDLFVYNSQHFVNNITLYQLNHLNSTSFSFIFLSGLFTSLSPCIISILPVCILYIAGE TQKLNPINKTKNLFLFCLGTISSFITLGILATLITKTYSQFFNGIPTISAVVIIYMGLNL LNIVHINSPKFNGLVTNNNYNFKMYLSGVGIGIAISSCSTPIFVTLLVWINSTQKIFTGL IFILIYSIGYIFPIIIGSIFSTSFLKLTESLSGIIMAPSVELCY
Uniprot No.

Target Background

Function
This protein may be involved in cytochrome c synthesis.
Protein Families
DsbD family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is cytochrome c biogenesis and how does DbsD-like protein function in this pathway?

Cytochrome c biogenesis refers to the process by which heme is covalently attached to the CXXCH (CysXxxXxxCysHis) motif of cytochrome c proteins. This attachment is essential for the proper function of cytochrome c in electron transport and energy production across diverse organisms from bacteria to humans . DbsD-like proteins are putative components of bacterial cytochrome c biogenesis systems that participate in the complex process of heme attachment to the apocytochrome.

In bacteria, there are two main cytochrome c biogenesis systems: System I (CcmABCDEFGH) and System II (CcsBA). DbsD-like proteins are believed to function within these systems, potentially participating in heme transport or attachment . The specific mechanisms of DbsD-like proteins remain less characterized compared to other components of these systems, making them important targets for current research.

How can recombinant putative cytochrome c-type biogenesis protein DbsD-like be expressed in laboratory settings?

Recombinant expression of cytochrome c biogenesis proteins, including DbsD-like proteins, can be accomplished using bacterial expression systems, primarily E. coli. The methodology involves cloning the gene of interest into an appropriate expression vector and co-expressing it with the necessary cytochrome c biogenesis components .

For DbsD-like proteins, researchers typically employ E. coli strains that contain the System I (CcmABCDEFGH) cytochrome c biogenesis pathway. This approach allows for efficient production and functional analysis of the recombinant protein. The general procedure includes:

  • Gene cloning into an expression vector with an appropriate promoter

  • Transformation into E. coli host cells

  • Induction of protein expression under optimized conditions

  • Cell lysis and protein purification using affinity tags such as His-tags

  • Confirmation of proper folding and activity using spectroscopic and functional assays

What analytical methods are used to verify successful expression of recombinant DbsD-like proteins?

Verification of successful recombinant expression of DbsD-like proteins involves multiple analytical techniques:

  • SDS-PAGE and Western blotting: Used to confirm the presence of the protein at the expected molecular weight and to assess purity

  • Heme staining: A specialized technique to detect heme-containing proteins following SDS-PAGE separation, which can identify if the DbsD-like protein is associated with heme or interacting with cytochrome c

  • UV-visible spectroscopy: Provides spectral signatures characteristic of heme proteins, with c-type cytochromes displaying distinctive absorption peaks at approximately 550 nm in the reduced state

  • Pyridine hemochrome assay: Used to quantify covalently attached heme and distinguish between different types of heme attachments

These methods collectively provide evidence for both the presence of the recombinant protein and its functional state in relation to cytochrome c biogenesis.

What is the CXXCH motif and why is it significant for studying DbsD-like proteins?

The CXXCH motif (where C represents cysteine, X represents any amino acid, and H represents histidine) is the conserved sequence in cytochrome c where heme is covalently attached via thioether bonds to the two cysteine residues . This motif is crucial for the function of cytochrome c and represents the key substrate recognition element for cytochrome c biogenesis machinery, including DbsD-like proteins.

The significance of this motif for studying DbsD-like proteins lies in understanding substrate recognition and the mechanism of heme attachment. Research has shown that different cytochrome c biogenesis systems (bacterial versus mitochondrial) have distinct requirements for recognizing the CXXCH motif and its surrounding amino acids . For bacterial systems potentially involving DbsD-like proteins, both thiols and the histidine in the CXXCH motif are required for recognition and heme attachment, while the adjacent alpha helix is less critical compared to mitochondrial systems .

How do bacterial and mitochondrial cytochrome c biogenesis systems differ, and where does DbsD-like protein fit in this comparison?

The differences between bacterial and mitochondrial cytochrome c biogenesis systems are substantial and impact how DbsD-like proteins are studied and understood:

FeatureBacterial Systems (I & II)Mitochondrial System (III)Implications for DbsD-like Research
Protein ComponentsSystem I: CcmABCDEFGH
System II: CcsBA
HCCS (holocytochrome c synthase)DbsD-like proteins function within the more complex bacterial systems
Substrate RecognitionBoth thiols and histidine in CXXCH required; alpha helix 1 not essentialMinimal 16-mer peptide required with CXXCH and alpha helix 1; thiols not critical for initial recognitionDifferent experimental approaches needed when studying DbsD-like proteins versus mitochondrial counterparts
Location of Heme Attachment"Outside" the cells after heme exportIntermembrane space of mitochondriaDbsD-like proteins may be involved in heme export or extracellular attachment processes
Release MechanismHeme-attached peptides appear to be releasedHeme-attached peptides not released from HCCS active site; folding necessary for releaseDbsD-like proteins may participate in distinct release/folding mechanisms

DbsD-like proteins are components of the bacterial systems, which are evolutionarily distinct from mitochondrial systems. Understanding these differences is crucial for designing experiments to characterize DbsD-like proteins and their specific roles in bacterial cytochrome c biogenesis.

What methodological approaches are optimal for in vitro reconstitution of DbsD-like protein activity?

In vitro reconstitution of DbsD-like protein activity requires careful consideration of experimental conditions to maintain protein functionality:

  • Protein Purification Strategy:

    • Detergent-solubilized purification for membrane-associated DbsD-like proteins

    • Tag systems (His-tag or GST-tag) can be employed for affinity purification

    • Protein stability must be maintained throughout the purification process

  • Reconstitution Conditions:

    • Anaerobic environment to prevent oxidation of thiols and heme

    • Reducing agents such as DTT to maintain cysteines in reduced form

    • Appropriate pH and ionic strength to mimic physiological conditions

    • Lipid or detergent micelles to support membrane protein function

  • Substrate Preparation:

    • Apocytochrome c or synthetic peptides containing the CXXCH motif

    • Control peptides with modified CXXCH motifs (e.g., CXXSH, SXXCH) to investigate specificity

  • Activity Assays:

    • UV-visible spectroscopy to monitor heme attachment (shift from b-type to c-type spectral features)

    • Heme staining of SDS-PAGE gels to visualize covalent attachment

    • Size-exclusion chromatography to assess complex formation and product release

The successful in vitro reconstitution of bacterial cytochrome c synthases like CcsBA provides a template for similar studies with DbsD-like proteins, though specific modifications may be necessary based on the unique properties of DbsD-like proteins.

How can researchers address the challenges of membrane protein purification when working with DbsD-like proteins?

Membrane protein purification presents specific challenges that researchers must address when working with DbsD-like proteins:

  • Optimized Solubilization:

    • Screening different detergents (DDM, LDAO, digitonin) to identify optimal solubilization conditions

    • Using mixed detergent systems or amphipols for improved stability

    • Adjusting detergent-to-protein ratios to prevent aggregation or denaturation

  • Expression Strategies:

    • Fusion tags that enhance membrane protein expression (e.g., GFP fusion)

    • Inducible promoters with fine control over expression levels

    • Co-expression with chaperones to improve folding and stability

  • Purification Considerations:

    • Two-step purification protocols (e.g., affinity chromatography followed by size exclusion)

    • On-column detergent exchange to transition from harsh to milder detergents

    • Inclusion of stabilizing ligands or cofactors during purification

  • Functional Validation Methods:

    • Reconstitution into proteoliposomes to verify activity in a membrane environment

    • Binding assays with cytochrome c or heme substrates

    • Spectroscopic techniques to assess heme environment and protein integrity

Successful examples from related systems, such as the purification of CcsBA with endogenous heme, demonstrate that these challenges can be overcome with careful optimization of conditions specific to the target protein.

What are the experimental approaches to investigate the interaction between DbsD-like proteins and heme?

Investigating interactions between DbsD-like proteins and heme requires multiple complementary approaches:

  • Spectroscopic Analysis:

    • UV-visible absorption spectroscopy to characterize heme binding (Soret and Q-bands)

    • Resonance Raman spectroscopy to probe the heme environment and axial ligands

    • Magnetic circular dichroism (MCD) to assess heme electronic structure

  • Mutagenesis Studies:

    • Site-directed mutagenesis of potential heme-binding residues (histidines, cysteines)

    • Creation of chimeric proteins to identify domains involved in heme binding

    • Alanine-scanning mutagenesis of conserved motifs

  • Heme Binding and Transfer Assays:

    • Titration experiments with varying heme concentrations

    • Stopped-flow kinetics to measure rates of heme binding

    • Competition assays with known heme-binding proteins or synthetic mimics

  • Structural Characterization:

    • X-ray crystallography of the protein-heme complex (if crystallizable)

    • NMR spectroscopy for solution structure determination

    • Cryo-electron microscopy for membrane protein complexes

These approaches can reveal whether DbsD-like proteins directly bind heme, potentially in a transient fashion during the biogenesis process, or if they interact with heme through other components of the cytochrome c biogenesis machinery.

How can structural biology techniques be applied to elucidate the function of DbsD-like proteins?

Structural biology offers powerful tools for understanding DbsD-like protein function:

For DbsD-like proteins, these techniques can help elucidate:

  • The structural basis for substrate recognition

  • Conformational changes during heme binding and transfer

  • Interfaces with other components of the cytochrome c biogenesis machinery

  • The topology and membrane integration of transmembrane domains

What are the optimal bacterial expression systems for recombinant DbsD-like proteins?

Selecting the appropriate bacterial expression system is crucial for successful production of recombinant DbsD-like proteins:

  • E. coli Strains:

    • BL21(DE3) and derivatives for high-level expression

    • C41(DE3) and C43(DE3) for membrane proteins

    • Origami or SHuffle strains for proteins requiring disulfide bond formation

  • Expression Vectors:

    • pET series with T7 promoter for high-level expression

    • pBAD vectors for arabinose-inducible, titratable expression

    • pASK vectors with tet promoter for gentle induction

  • Growth and Induction Conditions:

    • Lower temperatures (16-25°C) during induction to improve folding

    • Reduced inducer concentrations for slower, more controlled expression

    • Rich media supplemented with heme precursors or exogenous heme

  • Co-expression Strategies:

    • Co-expression with cytochrome c biogenesis components (e.g., CcmABCDEFGH)

    • Use of compatible plasmids with different origins of replication

    • Sequential induction of chaperones followed by target protein

The System I (CcmABCDEFGH) bacterial cytochrome c biogenesis pathway in E. coli has been successfully used for the recombinant expression of cytochrome c proteins and could be adapted for DbsD-like proteins .

What analytical techniques are most effective for characterizing the heme binding properties of DbsD-like proteins?

Characterization of heme binding to DbsD-like proteins requires a multi-technique approach:

  • Absorption Spectroscopy:

    • UV-visible spectra to identify characteristic peaks of bound heme

    • Reduced minus oxidized difference spectra to enhance spectral features

    • Pyridine hemochrome assay to quantify covalently bound heme

  • Advanced Spectroscopic Methods:

    • Magnetic circular dichroism to probe heme electronic structure

    • Electron paramagnetic resonance (EPR) for paramagnetic heme species

    • Resonance Raman spectroscopy for heme coordination environment

  • Binding Kinetics and Thermodynamics:

    • Isothermal titration calorimetry (ITC) for binding affinities and thermodynamics

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Stopped-flow spectroscopy for rapid binding events

  • Structural Approaches:

    • X-ray absorption spectroscopy (XAS) for local heme environment

    • NMR spectroscopy with isotopically labeled heme

    • Crosslinking studies to identify heme binding sites

These techniques provide complementary information about how DbsD-like proteins interact with heme, whether through direct binding or as part of a larger complex involved in heme transport and attachment to cytochrome c.

How can researchers effectively study the interaction between DbsD-like proteins and other components of the cytochrome c biogenesis system?

Investigating protein-protein interactions within the cytochrome c biogenesis system requires specialized approaches:

  • Co-purification and Pull-down Assays:

    • Tandem affinity purification to isolate native complexes

    • Pull-down assays with tagged DbsD-like proteins

    • Chemical crosslinking followed by mass spectrometry

  • Biophysical Interaction Analysis:

    • Biolayer interferometry for real-time interaction kinetics

    • Analytical ultracentrifugation to characterize complex formation

    • Microscale thermophoresis for binding affinity measurement in near-native conditions

  • In vivo Approaches:

    • Bacterial two-hybrid or split-protein complementation assays

    • Fluorescence resonance energy transfer (FRET) with fluorescently labeled proteins

    • Co-localization studies using fluorescence microscopy

  • Functional Reconstitution:

    • In vitro reconstitution with purified components

    • Activity assays in the presence or absence of interacting partners

    • Complementation studies in deletion strains

For DbsD-like proteins, these approaches can reveal their place within the complex machinery of cytochrome c biogenesis, identifying direct binding partners and functional relationships with other system components.

What strategies can be employed to overcome solubility and stability issues when working with recombinant DbsD-like proteins?

Membrane proteins like DbsD-like proteins often present solubility and stability challenges that can be addressed through various strategies:

  • Protein Engineering Approaches:

    • Truncation of flexible or hydrophobic regions

    • Fusion to solubility-enhancing tags (MBP, SUMO, TrxA)

    • Surface entropy reduction through mutation of flexible charged residues

  • Optimization of Buffer Conditions:

    • Screening of buffer components (pH, salt, additives)

    • Addition of glycerol or sucrose as stabilizing agents

    • Inclusion of specific ligands or cofactors that enhance stability

  • Alternative Solubilization Methods:

    • Nanodisc incorporation for membrane proteins

    • Amphipol stabilization after initial detergent solubilization

    • Styrene maleic acid lipid particles (SMALPs) for native lipid environment preservation

  • High-throughput Stability Screening:

    • Differential scanning fluorimetry to assess thermal stability

    • Limited proteolysis to identify stable domains

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to monitor oligomeric state

These approaches have proven successful for related membrane proteins involved in cytochrome c biogenesis, such as CcsBA, which was stabilized through GST fusion and careful detergent selection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.