Recombinant Putative cytochrome P450 141 (cyp141)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-400
Protein Length
full length protein
Target Names
cyp141
Target Protein Sequence
MTSTSIPTFPFDRPVPTEPSPMLSELRNSCPVAPIELPSGHTAWLVTRFDDVKGVLSDKR FSCRAAAHPSSPPFVPFVQLCPSLLSIDGPQHTAARRLLAQGLNPGFIARMRPVVQQIVD NALDDLAAAEPPVDFQEIVSVPIGEQLMAKLLGVEPKTVHELAAHVDAAMSVCEIGDEEV SRRWSALCTMVIDILHRKLAEPGDDLLSTIAQANRQQSTMTDEQVVGMLLTVVIGGVDTP IAVITNGLASLLHHRDQYERLVEDPGRVARAVEEIVRFNPATEIEHLRVVTEDVVIAGTA LSAGSPAFTSITSANRDSDQFLDPDEFDVERNPNEHIAFGYGPHACPASAYSRMCLTTFF TSLTQRFPQLQLARPFEDLERRGKGLHSVGIKELLVTWPT
Uniprot No.

Q&A

What is cytochrome P450 141 (cyp141) and where is it found?

Cytochrome P450 141 (cyp141) is a gene encoding an iron-containing hemoprotein that belongs to the cytochrome P450 family. In Mycobacterium tuberculosis, cyp141 serves as an important virulence factor . The gene is 1203 base pairs in length and is located in one of the 16 regions of differences (RD) that distinguish the genomes of M. tuberculosis from those of Mycobacterium bovis or Bacillus Calmette Guerin (BCG) . This genomic location makes cyp141 particularly valuable for diagnostic applications aimed at differentiating between these closely related mycobacterial species. The protein product of the cyp141 gene functions as a putative cytochrome P450, though some aspects of its specific enzymatic role in MTB pathogenesis continue to be investigated by researchers .

How does cyp141 differ between Mycobacterium tuberculosis and related species?

These differences highlight the importance of carefully designing primers that target specific nucleic acid segments within the cyp141 gene to achieve accurate differentiation between MTB-infected individuals, M. bovis-infected individuals, and BCG-vaccinated individuals . The cyp141-RealAmp method developed in recent research specifically targets the 1-1006 bp region of the cyp141 gene, which allows it to distinguish MTB from the genomes of M. bovis or BCG with high specificity . This is particularly important in clinical settings where distinguishing between these related mycobacterial species affects treatment decisions.

What are the common nomenclature conventions for cytochrome P450 genes like cyp141?

Cytochrome P450 (CYP) enzymes follow a standardized nomenclature system based on sequence homology. The naming convention typically follows the format CYPxyz*ij, where:

  • CYP represents cytochrome P450

  • x represents the family (assigned for proteins with ≥40% amino acid sequence identity)

  • y represents the subfamily (assigned for proteins with ≥55% identity)

  • z represents the individual gene

  • i represents the allele (denoted by an Arabic numeral)

  • j represents silent mutations (denoted by a capital letter)

Recent updates to this naming system, particularly as represented in the Pharmacogene Variation (PharmVar) Consortium database, use three decimal point digits after the allele name to represent silent alleles . The consensus or reference allele, which typically represents the major proportion of the population and confers normal enzyme activity, serves as the standard . An allele is classified as a pharmacogenetic polymorphism if it occurs at a frequency of at least 1% in a population .

In the case of cyp141 from Mycobacterium tuberculosis, it follows this naming convention as a member of the cytochrome P450 family. The numerical designation "141" places it within a specific subcategory of mycobacterial cytochrome P450 enzymes.

How is the cyp141-RealAmp assay designed and what are its technical specifications?

The cyp141-RealAmp assay is designed using loop-mediated isothermal amplification (LAMP) technology that targets the cyp141 gene of Mycobacterium tuberculosis. The assay employs six carefully designed oligonucleotide primers derived from the cyp141 gene sequence to detect MTB with high specificity and sensitivity .

The primer set includes:

  • Two inner primers (FIP and BIP)

  • Two outer primers (F3 and B3)

  • Two loop primers (LF and LB)

The specific primer sequences are shown in the table below:

Primer NameSequence (5'-3')Length
FIPTCCTCCGATCACGACGGTGAGCGGCAACAGTCCACCATG39
BIPACCGATCGCCGTGATCACAAAGTCTTCAACGAGCCGTTCAT41
LFGCATGCCGACAACCTGC17
LBTGCACCACCGCGATCAA17
F3CTTAGCACGATCGCCCAG18
B3TTCTTCAACCGCACGAGC18

The reaction mixture for the cyp141-RealAmp assay (25 μl total volume) consists of:

  • 1.6 μM of each inner primer

  • 0.2 μM of each outer primer

  • 0.8 μM of each loop primer

  • 2.5 μl of 10× Isothermo buffer (Mg²⁺-free)

  • 1.4 mM dNTPs

  • 8 mM Mg²⁺

  • 8 U of Bst DNA polymerase 3.0

  • 1 μl of fluorescent indicators (Calcein-Mn²⁺)

  • 5 μl of DNA template

The reaction is performed at a constant temperature of 65°C for 30 minutes using a thermostatic fluorescence detector (e.g., Genie II from OptiGene) . This isothermal approach eliminates the need for complex thermal cycling equipment required by PCR-based methods, making the assay more accessible for resource-limited settings.

The assay has a detection limit of 10 copies per reaction, demonstrating excellent analytical sensitivity . While some other methods may achieve slightly higher sensitivity (e.g., 6 copies per reaction), the cyp141-RealAmp method represents an optimal balance between sensitivity and cost-effectiveness for clinical applications .

How does the sensitivity and specificity of cyp141-based detection compare with other methods for MTB detection?

The cyp141-RealAmp assay demonstrates comparable performance to the WHO-approved Xpert MTB/RIF assay while offering specific advantages. Comparative analysis reveals the following performance metrics:

MethodSensitivity (95% CI)Specificity (95% CI)PPV (95% CI)NPV (95% CI)
Xpert MTB/RIF94.67% (91.28-98.06%)100% (89.78-100%)100% (97.08-100%)83.02% (72.91-93.13%)
cyp141-RealAmp92.90% (89.03-96.07%)100% (89.78-100%)100% (96.84-100%)78.57% (67.82-89.32%)

Both methods significantly outperform traditional detection approaches such as:

  • Acid-fast bacillus (AFB) smear: Detection rate of 57.40% (95% CI: 49.94-64.86%)

  • Culture: Detection rate of 65.68% (95% CI: 58.52-72.84%)

When analyzing different sample groups, the detection rates were as follows:

GroupStatusDetection Rate (95% CI)
Xpert MTB/RIF
AA+C+ (n = 71)100% (93.60-100%)
BA+C– (n = 26)93.51% (82.07-100%)
CA–C+ (n = 40)97.50% (92.66-100%)
DA–C– (n = 32)81.25% (67.73-94.77%)
EControl (n = 44)0%

Where:

  • A+C+: AFB positive, culture positive

  • A+C–: AFB positive, culture negative

  • A–C+: AFB negative, culture positive

  • A–C–: AFB negative, culture negative

  • Control: Patients with respiratory diseases other than TB

The concordance between cyp141-RealAmp and Xpert MTB/RIF was "highly significant" with a Kappa value of 0.89 , demonstrating excellent agreement between these two methods.

Notably, while the Xpert MTB/RIF assay detected one M. bovis positive sample as positive, the cyp141-RealAmp method correctly identified it as negative (not MTB), demonstrating the enhanced specificity of cyp141-RealAmp for differentiating between mycobacterial species .

What are the potential research limitations when working with recombinant cyp141?

When working with recombinant putative cytochrome P450 141 (cyp141), researchers should be aware of several potential limitations:

  • Variability in gene expression systems: Different expression systems (bacterial, yeast, mammalian) may yield varying results in terms of protein folding, post-translational modifications, and enzymatic activity. These differences can affect the functional properties of the recombinant cyp141 protein.

  • Conflicting specificity findings: Research has produced inconsistent results regarding the specificity of cyp141 for distinguishing between MTB and related species. While Darban reported that cyp141 is partially present in M. bovis and BCG, Farzam et al. found that their primers did not bind to M. bovis . This inconsistency necessitates careful primer design and validation.

  • Sample type limitations: The cyp141-RealAmp assay has been primarily validated with sputum samples. Its performance with other clinical sample types such as pleural fluid, cerebrospinal fluid, or fecal samples remains to be thoroughly evaluated .

  • Environmental stability: Reagent stability under different environmental conditions may affect assay performance, particularly in resource-limited settings. Current research suggests that preparing detection reagents in freeze-dried form could enhance transportability and shelf-life .

  • Genetic variation: Potential genetic polymorphisms in the cyp141 gene across different MTB strains could affect assay performance. Comprehensive sequence analysis across diverse geographical isolates is essential to ensure universal applicability.

  • Technical expertise requirements: While the cyp141-RealAmp method is simpler than some alternatives, it still requires basic laboratory infrastructure and technical expertise, which may limit its implementation in extremely resource-constrained settings.

Addressing these limitations through rigorous validation studies and methodological refinements will enhance the reliability and applicability of cyp141-based detection systems in diverse research and clinical contexts.

How can researchers optimize primer design for cyp141-based detection methods?

Optimizing primer design for cyp141-based detection methods is crucial for achieving high sensitivity and specificity. Based on the current research, here is a methodological approach for researchers:

  • Sequence analysis and target selection:

    • Obtain the complete cyp141 gene sequence (1203 bp) from reliable databases such as NCBI

    • Identify regions unique to MTB that differ from M. bovis and BCG

    • The 1-1006 bp region has shown promising results for MTB-specific detection

  • LAMP primer design principles:

    • Use specialized software such as "Primer Explorer" (http://primerexplorer.jp/e/) to generate candidate primer sets

    • Design a complete set of six primers: two inner primers (FIP/BIP), two outer primers (F3/B3), and two loop primers (LF/LB)

    • Ensure primers target conserved regions to minimize false negatives

    • Select primers with minimal potential for secondary structure formation or primer-dimer interactions

  • Specificity verification:

    • Perform in silico analysis using BLAST or similar tools to ensure primers do not cross-react with other mycobacterial species or common respiratory pathogens

    • Test primers against a panel of reference strains including MTB, M. bovis, BCG, non-tuberculous mycobacteria, and common respiratory bacteria

  • Optimization strategies:

    • Evaluate multiple primer concentrations (e.g., inner primers at 1.6 μM, outer primers at 0.2 μM, and loop primers at 0.8 μM have shown good results)

    • Optimize Mg²⁺ concentration (8 mM has been effective)

    • Test different DNA polymerase enzymes (Bst DNA polymerase 3.0 at 8 U per reaction has shown good performance)

    • Optimize reaction temperature and time (65°C for 30 minutes has been effective)

  • Validation:

    • Test with serial dilutions of synthetic templates to determine the limit of detection

    • Evaluate with a diverse set of clinical samples

    • Compare performance against gold standard methods

    • Calculate sensitivity, specificity, positive predictive value, and negative predictive value

By following these methodological steps, researchers can develop highly specific and sensitive cyp141-based detection methods that accurately differentiate between MTB and related mycobacterial species.

How does cyp141-based detection compare with traditional tuberculosis diagnostic methods?

The cyp141-RealAmp method offers significant advantages over traditional tuberculosis diagnostic techniques in terms of speed, sensitivity, and specificity. Here's a comprehensive comparison:

  • Ziehl-Neelsen staining (AFB smear):

    • Traditional method: Requires microscopic examination, has limited sensitivity (57.40% in comparative studies)

    • cyp141-RealAmp: Significantly higher sensitivity (92.90%), requires no specialized microscopy skills

    • Time advantage: AFB smear results typically available in hours; cyp141-RealAmp results in just 30 minutes

  • Culture methods (solid/liquid):

    • Traditional methods: Considered the gold standard but requires 2-8 weeks for results, with sensitivity around 65.68%

    • cyp141-RealAmp: Results available in 30 minutes with substantially higher sensitivity (92.90%)

    • Clinical impact: Faster diagnosis allows for earlier treatment initiation

  • Tuberculin skin test:

    • Traditional method: Cannot differentiate between active TB, latent TB, or BCG vaccination

    • cyp141-RealAmp: Specifically detects MTB, can differentiate from M. bovis/BCG

    • Accuracy advantage: Eliminates false positives due to BCG vaccination

  • Tuberculosis antibody detection:

    • Traditional method: Variable sensitivity and specificity, affected by immune status

    • cyp141-RealAmp: Direct detection of bacterial DNA, not affected by host immune response

    • Reliability advantage: More consistent performance across different patient populations

  • Liquid culture systems:

    • Traditional method: Faster than solid culture (1-3 weeks) but still slow compared to molecular methods

    • cyp141-RealAmp: Results in 30 minutes versus weeks

    • Resource advantage: Less laboratory infrastructure required

The cyp141-RealAmp assay effectively addresses many limitations of traditional methods by providing rapid results with high sensitivity and specificity, while requiring minimal infrastructure. This makes it particularly valuable for use in resource-limited settings where tuberculosis burden is often highest .

What is the potential for using cyp141 to differentiate between M. tuberculosis and M. bovis in research and clinical settings?

The cyp141 gene offers significant potential for differentiating between Mycobacterium tuberculosis and Mycobacterium bovis, which has important implications for both research and clinical applications. The ability to make this distinction is crucial because:

  • Treatment implications: While both species cause tuberculosis, M. bovis may have different drug susceptibility patterns, potentially requiring modified treatment approaches.

  • Epidemiological significance: Differentiating between these species helps in understanding transmission patterns and implementing appropriate public health interventions.

  • Zoonotic considerations: M. bovis primarily affects cattle but can transmit to humans, making species identification important for identifying potential animal-human transmission routes.

The cyp141-RealAmp assay has demonstrated specific advantages for this differentiation:

  • Empirical evidence: In one study, a sample that was M. bovis positive was correctly identified as negative by cyp141-RealAmp (since it targets MTB specifically) but was detected as positive by Xpert MTB/RIF (which detects the MTB complex more broadly) .

  • Precise targeting: By designing primers that target the 1-1006 bp region of the cyp141 gene, researchers have created a highly specific detection method that can distinguish MTB from the genomes of M. bovis or BCG .

  • Methodological approach: Researchers seeking to use cyp141 for species differentiation should:

    • Design primers targeting regions where sequence divergence exists between MTB and M. bovis

    • Validate with reference strains of both species

    • Test with clinical isolates from both human and animal sources

    • Compare results with conventional species identification methods

For optimal implementation in clinical settings, researchers might consider developing multiplex assays that simultaneously detect both species while differentiating between them, potentially incorporating additional genetic markers beyond cyp141 for enhanced reliability.

What quality control measures should be implemented when using recombinant cyp141 in experimental protocols?

When incorporating recombinant putative cytochrome P450 141 (cyp141) in experimental protocols, researchers should implement comprehensive quality control measures to ensure reliable and reproducible results. Here is a methodological framework for quality control:

  • Recombinant protein verification:

    • Confirm protein identity through mass spectrometry

    • Verify protein size and purity using SDS-PAGE

    • Assess protein folding through circular dichroism

    • Validate enzymatic activity using appropriate functional assays

    • Quantify protein concentration using standardized methods (Bradford assay, BCA assay)

  • Nucleic acid template controls for amplification assays:

    • Include positive controls with known quantities of synthetic cyp141 gene fragments

    • Use plasmids with inserted cyp141 sequences as standardized references

    • Create quantification standards using serial dilutions of templates (10⁰ to 10⁸ copies)

    • Include negative controls (RNase-free water) in each run

    • Test with reference MTB strains (e.g., H37Rv)

  • Assay performance validation:

    • Regularly assess detection limits (established at 10 copies per reaction for cyp141-RealAmp)

    • Evaluate inter-assay and intra-assay variability using replicate testing

    • Periodically test with a panel of non-MTB mycobacteria to confirm specificity

    • Include inhibition controls to detect potential sample inhibitors

    • Monitor time-to-positivity for consistency

  • Clinical sample processing controls:

    • Standardize sample collection, storage, and processing procedures

    • Include extraction controls to monitor DNA isolation efficiency

    • Process paired samples for comparison with reference methods

    • Implement blinding procedures for unbiased assessment

    • Document all pre-analytical variables

  • Data interpretation safeguards:

    • Establish clear positivity thresholds

    • Implement duplicate testing for discrepant results

    • Use statistical methods to calculate confidence intervals

    • Compare with reference methods using established statistical measures (Kappa statistics)

    • Document all analytical decision algorithms

By implementing these quality control measures, researchers can ensure the reliability and reproducibility of experiments utilizing recombinant cyp141, whether in basic research investigations or in the development and validation of diagnostic assays.

What are promising areas for future research using recombinant cyp141?

Several promising directions for future research utilizing recombinant putative cytochrome P450 141 (cyp141) merit exploration:

  • Development of point-of-care diagnostic platforms:

    • Integrating cyp141-RealAmp technology into portable, battery-operated devices

    • Creating lateral flow detection systems for amplification products

    • Developing smartphone-based fluorescence readers for field use

    • Exploring freeze-dried reagent formulations to enhance transportability and shelf-life in resource-limited settings

  • Expanded sample type validation:

    • Evaluating cyp141-based detection in non-sputum samples (pleural fluid, cerebrospinal fluid, feces, urine)

    • Optimizing sample processing protocols for different specimen types

    • Determining sample-specific detection limits and performance characteristics

    • Developing sample-specific quality control parameters

  • Structure-function studies:

    • Crystallizing recombinant cyp141 to determine three-dimensional structure

    • Investigating substrate specificity and enzymatic mechanisms

    • Exploring the role of cyp141 in MTB virulence and pathogenesis

    • Identifying potential inhibitors as novel drug candidates

  • Development of multiplex detection systems:

    • Creating assays that simultaneously detect multiple mycobacterial species

    • Incorporating drug resistance markers alongside cyp141 detection

    • Developing quantitative assays to monitor bacterial load during treatment

    • Designing comprehensive panels for differential diagnosis of respiratory infections

  • Evolutionary and comparative genomics:

    • Analyzing cyp141 sequence variations across clinical isolates from diverse geographical regions

    • Investigating the evolutionary history of cyp141 in pathogenic and non-pathogenic mycobacteria

    • Exploring functional consequences of natural polymorphisms in the cyp141 gene

    • Developing improved primers that accommodate sequence diversity while maintaining specificity

These research directions would significantly advance our understanding of cyp141's biological role while expanding its utility in clinical applications, particularly for tuberculosis diagnosis in resource-limited settings where rapid, accurate detection methods are critically needed.

How might emerging technologies enhance the application of cyp141 in tuberculosis research and diagnostics?

Emerging technologies present exciting opportunities to enhance cyp141 applications in tuberculosis research and diagnostics. Here's a methodological analysis of promising technological integrations:

  • CRISPR-Cas diagnostics:

    • Combine CRISPR-Cas12a or Cas13 systems with cyp141 detection

    • Methodology: Use cyp141-specific guide RNAs to direct Cas enzymes to MTB DNA/RNA, triggering collateral cleavage of reporter molecules

    • Advantages: Further improves sensitivity (potentially single-molecule detection), maintains specificity, and enables colorimetric readouts

    • Research approach: Design and optimize guide RNAs targeting cyp141, validate against diverse MTB strains, and compare with conventional detection methods

  • Nanopore sequencing:

    • Apply portable sequencing technologies to cyp141-based TB diagnosis

    • Methodology: Develop targeted sequencing protocols focusing on cyp141 and surrounding regions

    • Advantages: Provides sequence information beyond presence/absence, enables detection of variants, and offers insights into drug resistance

    • Implementation strategy: Design cyp141-specific sequencing adapters, optimize sample preparation protocols, and develop bioinformatic pipelines for rapid analysis

  • Microfluidic systems:

    • Integrate cyp141-RealAmp into lab-on-a-chip devices

    • Methodology: Design microfluidic chambers for sample processing, DNA extraction, and amplification

    • Advantages: Automation reduces technical expertise requirements, minimizes contamination risks, and enables precise control of reaction conditions

    • Development approach: Create prototype devices, optimize fluid dynamics, and validate against conventional methods

  • Artificial intelligence integration:

    • Apply machine learning to cyp141-based diagnostic data interpretation

    • Methodology: Train algorithms on amplification curves to distinguish true positives from background noise

    • Advantages: Improves sensitivity and specificity, reduces subjectivity in interpretation, and enables integration of multiple data streams

    • Research framework: Collect large datasets of amplification results, develop and train appropriate algorithms, and validate through blinded testing

  • Isothermal amplification enhancements:

    • Develop next-generation isothermal amplification methods targeting cyp141

    • Methodology: Explore alternatives to LAMP (e.g., recombinase polymerase amplification) or create hybrid methods

    • Advantages: Potentially further reduces reaction time, enhances sensitivity, and simplifies reaction components

    • Experimental approach: Screen enzyme combinations, optimize reaction conditions, and compare performance metrics

By methodically exploring these technological integrations, researchers can significantly enhance the utility of cyp141 in tuberculosis diagnostics, potentially creating systems that are more sensitive, specific, user-friendly, and appropriate for diverse clinical and research settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.