Recombinant Putative DNA utilization protein HofN (hofN)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hofN; SF3412; S4350; Putative DNA utilization protein HofN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Shigella flexneri
Target Names
hofN
Target Protein Sequence
MNPPINFLPWRQQRRTAFLRFWLLMFVAPLLLAVGITLILRLTGSAEARIDAVLLQAEQQ LARSLQITKPRLLEQQQLREQRSQRQRQRQFTRDWQSALEALAALLPEHAWLTTISWQQG TLEIKGLTTSITALNALETSLRQDASFHLNQRGATQQDAQGRWQFEYQLTRKVSDEHVL
Uniprot No.

Target Background

Function
Essential for utilizing extracellular DNA as a nutrient.
Database Links

KEGG: sfl:SF3412

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the function of HofN in bacterial systems?

HofN is classified as a putative DNA utilization protein that plays a critical role in bacterial nutritional competence. Research has demonstrated that HofN, along with other com gene homologs in Escherichia coli, is necessary for the use of extracellular DNA as a sole source of carbon and energy . This function represents a form of natural competence referred to as "nutritional competence," which differs from genetic competence associated with bacterial transformation .

Functional studies show that mutations in the hofN gene result in bacteria unable to utilize DNA as a nutrient source, with mutant strains showing drastically reduced growth yields (≤3-fold increase) compared to wild-type strains (∼120-fold increase) when provided with DNA as the sole carbon source . Additionally, these genes confer a competitive advantage during long-term stationary-phase incubation, suggesting their importance in bacterial survival during nutrient limitation.

How are recombinant HofN proteins typically produced?

Recombinant HofN proteins are typically produced using bacterial expression systems with affinity tags to facilitate purification. Available recombinant HofN proteins include:

Cat.#Product nameSource (Host)SpeciesTagProtein Length
RFL14467EFRecombinant Full Length Escherichia Coli Putative Dna Utilization Protein Hofn(Hofn) ProteinE.coliE.coliHisFull Length (1-179)
RFL15932SFRecombinant Full Length Putative Dna Utilization Protein Hofn(Hofn) ProteinE.coliShigella flexneriHisFull Length (1-179)

The recombinant proteins are typically stored in Tris-based buffer with 50% glycerol at -20°C, with recommendations against repeated freeze-thaw cycles .

What are the optimal methods for studying HofN's role in DNA utilization?

To study HofN's role in DNA utilization, researchers should employ a multi-faceted approach:

  • DNA Consumption Assays: Implement the "DNA-eating" assay in which purified DNA (such as sonicated salmon sperm DNA) is provided as the sole carbon and energy source in minimal media at 0.1% (wt/vol). Compare growth of wild-type strains with hofN mutants over 24 hours, measuring final growth yields .

  • Competitive Fitness Assays: Conduct long-term stationary-phase competition experiments between wild-type and hofN mutant strains to assess the contribution of HofN to survival under nutrient limitation. These experiments reveal that com gene homologs, including HofN, confer a competitive advantage during extended stationary phase .

  • Gene Complementation Studies: For confirmation of phenotypes, introduce the wild-type hofN gene back into mutant strains using low-copy-number vectors such as pWSK29, pWKS30, pWSK129, or pWKS130 .

  • Covariance Analysis: Implement sequence covariance analysis to identify potential residue-residue interactions between the N-terminal hydrophobic domain and other parts of the protein, providing insights into structural features critical for function .

How should researchers design experiments to study HofN membrane topology?

Studying the membrane topology of HofN requires specialized techniques to confirm its predicted reentrant structure:

  • Hydrophobicity Profiling: Analyze the N-terminal domain for hydrophobic regions that might function as reentrant domains using prediction algorithms that specifically consider conserved helix-breaking residues and positive charges preceding the hydrophobic segment .

  • Fusion Protein Approach: Create fusion proteins with reporter domains (such as GFP, alkaline phosphatase, or β-lactamase) at various positions to determine which regions are exposed to different cellular compartments.

  • Cysteine Accessibility Methods: Introduce cysteine residues at strategic positions and assess their accessibility to membrane-impermeable sulfhydryl reagents to map protein topology.

  • Protease Protection Assays: Use limited proteolysis with membrane preparations to identify protected regions of the protein.

  • Covariance Analysis Validation: Employ covariance analysis on sequence homologs to confirm probable contacts between the N-terminal hydrophobic domain and the rest of the protein structure, which would support a reentrant topology rather than a transmembrane one .

How can researchers investigate protein-protein interactions involving HofN?

Investigating HofN's protein-protein interactions requires multiple complementary approaches:

  • Coevolution Analysis: Examine residue-residue coevolution between HofN and other proteins across bacterial proteomes using methods that detect coevolutionary signals. This approach has been successfully applied to identify protein-protein interactions in E. coli with higher accuracy than proteome-wide two-hybrid and mass spectrometry screens .

  • Yeast Two-Hybrid: Implement modified yeast two-hybrid systems suitable for membrane proteins to screen for potential interaction partners.

  • Co-immunoprecipitation: Use tagged versions of HofN to pull down interacting proteins from cell lysates, followed by mass spectrometry identification.

  • Cross-linking Studies: Apply in vivo cross-linking to capture transient interactions followed by proteomics analysis.

  • Bacterial Two-Hybrid Systems: Consider specialized bacterial two-hybrid systems that may be more appropriate for studying bacterial membrane protein interactions.

  • Proximity Labeling: Employ techniques such as BioID or APEX2 proximity labeling to identify proteins in close proximity to HofN in living cells.

What methods can distinguish between HofN's roles in nutritional competence versus genetic transformation?

Distinguishing between these roles requires specific experimental designs:

  • DNA Utilization Assays: Measure growth when DNA is provided as the sole carbon and energy source (nutritional competence) using wild-type and hofN mutant strains .

  • Transformation Frequency Assays: Assess the ability of cells to take up and integrate exogenous DNA carrying selectable markers.

  • Differential Gene Expression Analysis: Compare expression patterns of hofN under conditions favoring either nutritional competence or genetic transformation.

  • DNA Binding and Uptake Assays: Use fluorescently labeled DNA to track binding to the cell surface and subsequent internalization.

  • Separating the Pathways: Design constructs with mutations specifically affecting one pathway but not the other, based on structural and functional analyses.

The experimental evidence strongly suggests that HofN is primarily involved in nutritional competence in E. coli, as demonstrated by its necessity for using DNA as a nutrient source and its contribution to competitive survival in environments with limited nutrients .

What are the optimal expression systems for recombinant HofN production?

Based on the available literature and common practices in recombinant protein production:

  • Bacterial Expression Systems: E. coli BL21(DE3) or its derivatives are commonly used for recombinant HofN production, with expression vectors containing T7 or tac promoters.

  • Affinity Tags: Histidine tags are frequently used for purification of recombinant HofN proteins as evidenced by commercially available products .

  • Induction Conditions: IPTG-inducible promoters with careful optimization of induction conditions (temperature, IPTG concentration, and duration) are critical for obtaining soluble protein, especially for membrane-associated proteins like HofN.

  • Solubility Considerations: Given HofN's hydrophobic N-terminal domain, expression conditions may need optimization to prevent inclusion body formation. Consider lower induction temperatures (16-25°C) and reduced inducer concentrations.

  • Membrane Protein Extraction: For membrane-associated proteins like HofN, specialized extraction protocols using mild detergents may be necessary to maintain native conformation.

What mutagenesis approaches are most informative for HofN functional studies?

Several mutagenesis strategies can provide valuable insights into HofN function:

  • Domain-Specific Mutations: Target the N-terminal hydrophobic domain, focusing on conserved helix-breaking residues and positively charged residues preceding the hydrophobic segment .

  • Alanine Scanning: Systematically replace amino acids with alanine to identify residues critical for function.

  • Knock-out Mutations: Complete gene deletion using recombineering approaches or CRISPR-Cas9 systems to study loss-of-function phenotypes .

  • Chimeric Proteins: Create chimeras between HofN from different bacterial species to identify species-specific functional differences.

  • Conservative vs. Non-conservative Substitutions: Compare effects of conservative (maintaining chemical properties) versus non-conservative substitutions to refine understanding of structure-function relationships.

Research has shown that hofN mutants are unable to use DNA as a sole carbon and energy source, confirming its essential role in nutritional competence .

How conserved is HofN across bacterial species, and what does this suggest about its function?

The conservation pattern of HofN provides important insights into its function:

  • Distribution Among Proteobacteria: Homologs of HofN and related com genes are found throughout the proteobacteria, suggesting that the use of DNA as a nutrient may be a widespread phenomenon .

  • Sequence Conservation: The HofN protein sequence is highly conserved between closely related species such as E. coli and Shigella flexneri, with nearly identical amino acid sequences .

  • Functional Conservation: The conservation of HofN across bacterial species suggests an important selective advantage conferred by nutritional competence, particularly in environments with limited nutrients.

  • Phylogenetic Analysis: Comparative genomic studies show that genes involved in nutritional competence, including hofN, are more widely distributed than those specifically involved in genetic transformation, suggesting that nutritional use of DNA may be an ancestral function.

  • Structural Motif Conservation: The reentrant membrane topology of HofN appears to be a conserved feature among its homologs, indicating its structural importance for function .

How can researchers apply coevolutionary analysis to identify HofN interaction networks?

Coevolutionary analysis is a powerful approach for identifying protein interaction networks:

  • Methodology: Use mutual information-based approaches or global statistical models to detect coevolution between protein pairs by analyzing paired alignments of putative orthologs across multiple bacterial genomes .

  • Data Requirements: Analyze sufficient sequence pairs with adequate sequence information (typically Nf ≥ 16) to assess coevolution meaningfully .

  • Interaction Prediction: Strong coevolutionary signals between HofN and other proteins can predict physical interactions that may be part of a functional network involved in DNA utilization.

  • Network Construction: Build interaction networks based on coevolutionary strength, which can reveal previously uncharacterized components of the DNA utilization system.

  • Experimental Validation: Follow up computational predictions with experimental validation using methods described in section 3.1.

Research has shown that coevolutionary analysis can identify protein-protein interactions with higher accuracy than traditional experimental methods like yeast two-hybrid and mass spectrometry screens .

What are the key quality control measures for recombinant HofN preparations?

Ensuring high-quality recombinant HofN preparations requires thorough quality control:

  • Purity Assessment: SDS-PAGE analysis with Coomassie or silver staining to verify protein purity, with mass spectrometry confirmation of identity.

  • Functional Assays: Verify function using DNA binding assays or nutritional competence complementation studies with hofN mutants.

  • Storage Conditions: Store in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage. Avoid repeated freeze-thaw cycles by preparing working aliquots for storage at 4°C for up to one week .

  • Western Blot Analysis: Confirm protein identity and integrity using antibodies against HofN or the affinity tag.

  • Endotoxin Testing: For applications sensitive to bacterial endotoxins, implement endotoxin testing and removal protocols.

What regulatory considerations apply to research with recombinant HofN?

When working with recombinant HofN, researchers should consider:

  • NIH Guidelines Compliance: Research involving recombinant DNA molecules must comply with the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, especially if the institution receives NIH funding .

  • Institutional Biosafety Committee Approval: Experiments involving recombinant DNA constructs may require registration and approval by the institution's Biological Safety Committee .

  • Laboratory Safety: Follow appropriate biosafety practices based on the risk assessment of the experimental procedures and materials.

  • Intellectual Property Considerations: Be aware of patent considerations when using recombinant proteins and expression systems in research, especially if there are plans for commercial applications .

  • Documentation Requirements: Maintain detailed records of experimental procedures, results, and safety measures as required by institutional policies and regulations.

What are the emerging technologies that could advance HofN research?

Several cutting-edge technologies show promise for advancing HofN research:

  • Cryo-Electron Microscopy: High-resolution structural studies of HofN in its native membrane environment to determine precise topology and potential conformational changes.

  • Single-Molecule Techniques: Real-time observation of HofN-mediated DNA binding and processing using single-molecule fluorescence techniques.

  • CRISPR-Cas9 Applications: Precise genome editing to create specific mutations or regulatory modifications in the hofN gene to study its regulation and function in vivo.

  • Advanced Computational Modeling: Molecular dynamics simulations to understand protein-membrane interactions and protein-protein interactions involving HofN.

  • Synthetic Biology Approaches: Engineer synthetic circuits incorporating HofN to develop new biotechnological applications based on its DNA utilization capabilities.

How might understanding HofN function contribute to biotechnological applications?

Understanding HofN function could enable various biotechnological applications:

  • DNA Recycling Systems: Develop systems for efficient DNA recycling in industrial processes based on the natural ability of bacteria to utilize DNA as a nutrient.

  • Genetic Engineering Tools: Exploit natural competence mechanisms for new transformation methods in difficult-to-transform organisms.

  • Bioremediation: Engineer bacteria with enhanced DNA utilization capabilities for environmental applications, such as breaking down DNA in contaminated environments.

  • Synthetic Biology Circuits: Incorporate DNA sensing and utilization systems into synthetic circuits for novel applications in biotechnology.

  • Antimicrobial Strategies: Target DNA utilization pathways as potential novel antimicrobial targets, particularly for bacteria that rely on external DNA for survival during nutrient limitation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.