Recombinant Putative epimerase lsrE (lsrE)

Shipped with Ice Packs
In Stock

Description

General Information

The compound "Recombinant Putative epimerase lsrE (lsrE)" can refer to two distinct molecules: a putative epimerase involved in bacterial polysaccharide synthesis and a human protein called lipolysis-stimulated lipoprotein receptor (LSR) .

Putative Epimerase LsrE (lsrE) in Bacteria

In bacteria, LsrE is a putative epimerase, an enzyme that catalyzes the inversion of stereochemical configuration at a single chiral center in a molecule. Specifically, it may function as a UDP-N-acetylglucosamine-4-epimerase .

  • Function Yersinia enterocolitica O:8 and O:3 galE/ lse genes encode a UDP-N-acetylglucosamine-4-epimerase .

  • Role in LPS Biosynthesis LsrE is involved in the biosynthesis of lipopolysaccharides (LPS), which are characteristic components of the outer membrane of Gram-negative bacteria .

  • Complementation Studies Studies have shown that the galE/ lse gene can complement the SR-LPS phenotype, contributing to the biosynthesis of the O-antigen .

  • Enzyme Activity LsrE exhibits UDP-glucose-4-epimerase activity, which is essential for K-12 LPS core production in E. coli .

Lipolysis-Stimulated Lipoprotein Receptor (LSR) in Humans

In humans, LSR is a tight junction protein that acts as a host defense factor against SARS-CoV-2. It inhibits the interaction between the viral Spike protein and the ACE2 receptor, thus preventing viral entry into cells .

  • Host Defense LSR functions as a host defense factor against SARS-CoV-2 by impairing S protein binding to ACE2 .

  • Interaction with ACE2 LSR interacts with ACE2 both in cis and in trans, preventing its binding to the S protein .

  • Antiviral Activity Overexpression of LSR significantly decreased viral load and mitigated tissue damage in the intestines of K18-hACE2-LSR-OE mice compared to K18-hACE2-WT mice .

  • Location LSR suppresses SARS-CoV-2 infection in the small intestine .

D-Allulose 3-Epimerase

  • Production D-Allulose 3-epimerase from Flavonifractor plautii was cloned and expressed in Escherichia coli and Corynebacterium glutamicum .

  • Activity The maximum activity of the enzyme purified from recombinant E. coli cells was observed at pH 7.0, 65°C, and 1 mM Co2+ with a half-life of 40 min at 65°C, Km of 162 mM, and kcat of 25280 1/s .

Site-Specific Recombinases

  • Function Site-specific recombinases are valuable tools for basic research and genetic engineering because they promote high-fidelity DNA modifications .

  • Applications Site-specific recombination systems have empowered researchers with unprecedented control over diverse biological functions, enabling insights into cellular structure and function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
lsrE; STY3790; t3538; Putative epimerase LsrE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Salmonella typhi
Target Names
lsrE
Target Protein Sequence
MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCP QFTVGPWAVGQLPQTFIKDVHLMVADQWAAAQACVKAGAHCITLQAEGDIHLHHTLSWLG QQTVPVIDGEMPVIRGISLCPATPLDVIIPILSDVEVIQLLAVNPGYGSKMRSSDLYERV AQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLVENTRSWRAM FKVAGDTTFLPSTA
Uniprot No.

Target Background

Database Links

KEGG: stt:t3538

STRING: 220341.STY3790

Protein Families
Ribulose-phosphate 3-epimerase family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is putative epimerase lsrE and what organism does it originate from?

Putative epimerase lsrE is an enzyme belonging to the ribulose-phosphate 3-epimerase family. It is found in Salmonella choleraesuis (strain SC-B67). The enzyme has not been fully characterized, but based on sequence homology, it is predicted to catalyze the reversible epimerization of specific substrates by changing the stereochemistry at one carbon center . Similar epimerases are involved in carbohydrate metabolism and modification pathways.

What are the optimal storage conditions for recombinant lsrE protein?

For short-term storage, recombinant lsrE should be stored at 4°C for up to one week. For extended storage, the protein should be maintained at -20°C or -80°C in a buffer containing 50% glycerol to prevent freeze-thaw damage. The recommended storage buffer is a Tris-based buffer optimized for protein stability . Repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of activity. If multiple experiments are planned, it is advisable to prepare small working aliquots.

How does lsrE compare to other characterized epimerases?

While lsrE remains largely uncharacterized, we can draw comparisons with other epimerases based on sequence homology:

EpimeraseOrganismOligomeric StateSubstrate SpecificityCofactor RequirementNotable Features
lsrESalmonella choleraesuisUnknown (predicted dimeric)UnknownUnknown (likely metal-dependent)Belongs to ribulose-phosphate 3-epimerase family
MetLRE (L-ribulose 3-epimerase)Methylomonas sp.HomodimericL-ribulose, D-ribulose, D-alluloseMetal ion (likely)First reported dimeric L-ribulose 3-epimerase
DAEases (D-allulose 3-epimerases)Various bacteriaUsually homotetramericD-fructose, D-alluloseCo²⁺, Mn²⁺Used for D-allulose production
AGME (ADP-heptose 6-epimerase)BacteriaUnknownADP-β-L-glycero-D-manno-heptoseNADP⁺Involved in lipopolysaccharide biosynthesis

What expression systems are recommended for recombinant lsrE production?

Based on successful approaches with similar epimerases, the following expression system is recommended:

  • Host strain: Escherichia coli BL21(DE3) is the preferred expression host due to its reduced protease activity and compatibility with T7 promoter-based expression systems .

  • Expression vector: Vectors containing the T7 promoter (pET series) are recommended, with either N-terminal or C-terminal His-tag for purification. For lsrE specifically, a construct similar to those used for other epimerases can be designed .

  • Culture conditions:

    • Grow cultures in LB medium supplemented with appropriate antibiotics at 37°C until OD₆₀₀ reaches 0.6-0.8

    • Induce with IPTG (0.1-0.5 mM final concentration)

    • Reduce temperature to 16-25°C for overnight expression to enhance protein solubility

  • Optimization considerations:

    • Co-expression with chaperones may improve solubility

    • Inclusion of metal ions in the growth medium might enhance folding if lsrE is metal-dependent

    • Testing different induction temperatures and IPTG concentrations to optimize yield versus solubility

What purification strategy should be employed for recombinant lsrE?

A multi-step purification approach is recommended:

  • Cell lysis: Resuspend cells in lysis buffer (20 mM Tris-HCl, 20 mM imidazole, 500 mM NaCl, pH 8.0) and disrupt by sonication or French press .

  • Initial purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein.

    • Wash with increasing imidazole concentrations (20-50 mM)

    • Elute with 250-500 mM imidazole

  • Secondary purification: Size exclusion chromatography to obtain homogeneous protein and determine oligomeric state.

    • Buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, potentially supplemented with metal cofactors

  • Quality control:

    • SDS-PAGE analysis for purity assessment

    • Native PAGE to determine oligomeric state

    • Mass spectrometry for identity confirmation

    • Circular dichroism for secondary structure analysis

How should enzyme activity assays be designed for lsrE characterization?

Without confirmed substrate specificity, a systematic approach is necessary:

  • Substrate screening: Test potential substrates based on related epimerases:

    • Monosaccharides: D-fructose, L-ribulose, D-ribulose, D-tagatose, D-allulose

    • Sugar phosphates: ribulose-5-phosphate, xylulose-5-phosphate

    • Nucleotide sugars: if relevant based on genomic context

  • Assay methods:

    • Coupled enzymatic assays: Linking epimerization to NADH-dependent reactions for spectrophotometric monitoring

    • HPLC analysis: For direct quantification of substrate and product

    • Mass spectrometry: For definitive identification of reaction products

    • NMR spectroscopy: For structural confirmation of epimerization products

  • Reaction conditions optimization:

    • pH screening (pH 5-9)

    • Temperature range (25-65°C)

    • Metal cofactor dependency (Mn²⁺, Co²⁺, Mg²⁺, Zn²⁺)

    • Buffer composition and ionic strength

What techniques can be used to determine the metal cofactor requirements of lsrE?

A comprehensive approach to determining metal cofactor requirements includes:

  • Metal dependency screening:

    • Purify protein in the presence of EDTA to remove endogenous metals

    • Test activity restoration with different metal ions (Mn²⁺, Co²⁺, Mg²⁺, Zn²⁺)

    • Determine optimal metal concentration (typically 0.1-5 mM)

  • Structural analysis:

    • Inductively coupled plasma mass spectrometry (ICP-MS) to quantify bound metals

    • X-ray crystallography to visualize metal-binding sites

    • Homology modeling to predict metal-binding residues

  • Site-directed mutagenesis:

    • Target predicted metal-binding residues (often His, Asp, Glu)

    • Confirm the essential role of these residues in metal binding and catalysis

How can isotope incorporation studies elucidate the catalytic mechanism of lsrE?

Isotope incorporation studies are powerful tools for determining the reaction mechanism of epimerases. For lsrE, the following approaches can be adapted from studies on similar enzymes :

  • Deuterium incorporation:

    • Perform reactions in D₂O buffer to detect solvent-derived deuterium incorporation

    • Mass spectrometry and NMR analysis can identify positions of deuterium incorporation

    • Absence of deuterium incorporation would suggest a non-stereospecific oxidation/reduction mechanism similar to AGME

  • ¹⁸O-isotope studies:

    • Conduct reactions in H₂¹⁸O to detect oxygen exchange

    • Absence of ¹⁸O incorporation would rule out dehydration/rehydration mechanisms

  • Substrate analogs:

    • Synthesize position-specific deoxygenated substrate analogs

    • Test whether modification at specific positions prevents catalysis

    • This approach identified that C-6 is the site of oxidation in AGME

What structure-guided mutagenesis approaches could enhance lsrE catalytic properties?

Based on successful mutagenesis studies with other epimerases, the following approaches are recommended :

  • Comparative sequence analysis:

    • Align lsrE with characterized epimerases to identify conserved catalytic residues

    • Target residues corresponding to metal coordination sites (typically Glu, Asp, His)

    • Identify substrate-binding residues for specificity engineering

  • B-factor analysis from homology models:

    • Identify regions with high B-factors that indicate flexibility

    • Target these regions to improve thermostability

    • Previous studies on D-allulose 3-epimerases showed that reducing flexibility in these regions enhanced thermostability

  • Active site engineering:

    • Modify residues involved in substrate recognition to alter specificity

    • For example, the G36N/W112E double mutation in CbDAE resulted in 4.21-fold enhancement of catalytic activity

  • Interface engineering:

    • For multimeric enzymes, strengthen subunit interactions to improve stability

    • Introduce cation-π interactions or additional hydrogen bonds at subunit interfaces

How can the quaternary structure of lsrE affect its catalytic properties?

The quaternary structure of epimerases significantly impacts their properties:

  • Oligomeric state determination:

    • Size exclusion chromatography

    • Native PAGE

    • Dynamic light scattering

    • Analytical ultracentrifugation

  • Structure-function relationships:

    • Dimeric L-ribulose 3-epimerases like MetLRE show different C-terminal α-helix structures compared to tetrameric counterparts, which affects stability and activity

    • The length of the C-terminal α-helix correlates with oligomerization state in some epimerases

  • Engineering approaches:

    • Addition or removal of C-terminal residues can potentially alter the oligomeric state

    • The addition of residues to MetLRE at the C-terminus did not lead to tetramer formation, suggesting more complex determinants of quaternary structure

What are the appropriate controls for studying potential contaminating enzymatic activities?

When characterizing a novel enzyme like lsrE, it's crucial to rule out contaminating activities:

  • Negative controls:

    • Inactive enzyme (heat-denatured or with catalytic residues mutated)

    • Empty vector control (host containing expression vector without lsrE gene)

    • Metal-free enzyme preparation (if metal-dependent)

  • Specificity controls:

    • Test activity with structurally related non-substrates

    • Verify product formation using multiple analytical methods (HPLC, MS, NMR)

    • Demonstrate reversibility of the epimerization reaction

  • Inhibition studies:

    • Use specific inhibitors of potential contaminating enzymes

    • Test activity in the presence of EDTA to chelate metals and confirm metal dependency

How can genomic context analysis help understand the physiological role of lsrE?

Genomic context analysis can provide valuable insights into lsrE function:

  • Operon analysis:

    • Identify genes co-localized with lsrE in the Salmonella genome

    • Determine if lsrE is part of a metabolic operon or gene cluster

  • Comparative genomics:

    • Examine distribution of lsrE homologs across bacterial species

    • Correlate presence/absence with specific metabolic pathways

  • Transcriptional analysis:

    • Determine conditions under which lsrE is expressed

    • Identify potential transcriptional regulators

  • Integration with metabolism:

    • Based on genomic context, propose potential metabolic pathways involving lsrE

    • Design biochemical assays to test these hypotheses

What experimental approaches can confirm the in vivo function of lsrE?

To validate the physiological role of lsrE:

  • Gene knockout studies:

    • Generate lsrE deletion mutants in Salmonella

    • Analyze phenotypic changes (growth, metabolism, virulence)

    • Perform metabolomic profiling to identify accumulated substrates

  • Complementation experiments:

    • Reintroduce wild-type or mutant lsrE into knockout strains

    • Test restoration of wild-type phenotype

    • Use point mutations in catalytic residues to confirm enzymatic function

  • In vivo substrate identification:

    • Perform metabolomics comparing wild-type and lsrE mutant strains

    • Use stable isotope labeling to track metabolic fluxes

    • Apply untargeted metabolomics to identify unexpected substrates

How might advanced protein engineering techniques be applied to lsrE?

Beyond traditional site-directed mutagenesis, several advanced approaches could be applied:

  • Directed evolution:

    • Develop high-throughput screening methods for lsrE activity

    • Generate random mutagenesis libraries

    • Apply iterative selection for improved properties (stability, activity, specificity)

  • Computational design:

    • Use Rosetta or similar platforms for in silico design of improved variants

    • Apply molecular dynamics simulations to understand conformational dynamics

    • Employ machine learning approaches to predict beneficial mutations

  • Domain swapping or fusion:

    • Exchange domains with related epimerases to create chimeric enzymes

    • Fuse lsrE with other enzymes to create bifunctional catalysts for cascade reactions

What potential biotechnological applications might emerge from lsrE research?

While commercial applications were not the focus of this FAQ, potential future research directions include:

  • Biocatalysis applications:

    • If lsrE shows activity toward valuable sugars or sugar derivatives, it could be developed for specific biocatalytic applications in research

    • Engineered variants with improved properties could expand the enzyme's utility

  • Tool development:

    • Development of lsrE as a research tool for specific epimerization reactions

    • Creation of biosensors based on lsrE activity for detecting specific metabolites

  • Structural biology contributions:

    • Structural studies of lsrE could advance understanding of epimerase mechanisms

    • Novel insights could inform broader enzyme engineering efforts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.