Recombinant Putative ethidium bromide resistance protein (ebr)

Shipped with Ice Packs
In Stock

Description

Discovery and Occurrence

The Bacillus subtilis genome encodes seven homologues of the small multidrug resistance (SMR) family of drug efflux pumps . Six of these homologues are paired in three distinct operons . Escherichia coli also encodes SMR homologues . These proteins, including Ebr, provide resistance against multiple drugs .

Function and Mechanism

Ebr proteins are typically small, integral membrane proteins that function as drug efflux pumps . They belong to the SMR family of transporters and confer resistance to various toxic compounds . The Ebr protein inhibits ethidium bromide accumulation, reducing its intracellular concentration .

Structure and Characteristics

Ebr proteins are generally composed of around 110 to 120 amino acids . They possess a characteristic SMR domain, which contains transmembrane segments that facilitate the transport of substrates across the cell membrane .

Recombinant Production

Recombinant Ebr proteins are produced using recombinant DNA technology, where the gene encoding Ebr is cloned and expressed in a host organism such as E. coli . The recombinant protein can be purified and used for various research purposes, including structural and functional studies .

To produce recombinant Ebr:

  1. The gene encoding Ebr is amplified by PCR and cloned into an expression vector .

  2. The expression vector is transformed into E. coli for protein production .

  3. Ebr expression is induced by adding arabinose .

  4. The recombinant Ebr protein is purified using affinity chromatography .

Biological Significance

Ebr proteins play a crucial role in bacterial resistance to multiple drugs . These proteins protect bacteria from the toxic effects of ethidium bromide and other antimicrobial compounds . Understanding the function and mechanism of Ebr proteins is important for developing strategies to combat multidrug resistance in bacteria .

EBR-5: A Novel Variant of Metallo-β-Lactamase EBR

EBR-5, a novel metallo-β-lactamase (MBL) EBR variant, was identified in a multidrug-resistant Empedobacter stercoris strain SCVM0123 . EBR-5 shared 82.13% amino acid identity with the previously known EBR-1 . The expression of EBR-5 in Escherichia coli reduced susceptibility to expanded-spectrum cephalosporins and carbapenems .

Compared with bla EBR-1, the recombinant strain harboring bla EBR-5 exhibited higher minimum inhibitory concentrations of piperacillin, cefotaxime, and meropenem . Despite the genetic diversity, EBR-5 and EBR-1 possessed similar kinetic parameters, except for cefepime, cefotaxime, cefoxitin, cephalothin, and meropenem, which were hydrolyzed more by EBR-5 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ebr; E1; Putative ethidium bromide resistance protein; E1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Salmonella typhimurium
Target Names
ebr
Target Protein Sequence
MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAY AVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIIAAFLLARSPSWKSLRRPTPW
Uniprot No.

Target Background

Function
A determinant of resistance to ethidium bromide and quaternary ammonium compounds.
Protein Families
Small multidrug resistance (SMR) protein family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the EbrAB system and how was it initially identified?

The EbrAB system consists of two components, EbrA and EbrB, which together form a functional multidrug efflux pump in Bacillus subtilis. This system was initially identified through cloning experiments using chromosomal DNA from B. subtilis ATCC 9372. Researchers discovered that when both genes were introduced into E. coli KAM3 (a strain lacking the AcrAB efflux system), the recombinant bacteria exhibited elevated resistance to ethidium bromide and other compounds . What makes this system particularly noteworthy is that neither gene alone was sufficient to confer resistance; both EbrA and EbrB are necessary for the functionality of the efflux pump .

How does the EbrAB system differ from other members of the SMR family?

The most distinctive feature of the EbrAB system is its two-component nature. In most previously characterized members of the small multidrug resistance (SMR) family, such as those found in Staphylococcus aureus and Escherichia coli, only a single gene product is required for drug efflux activity . The EbrAB system represents a novel variation within this family, requiring both EbrA and EbrB proteins to function effectively as a multidrug efflux pump . This structural and functional difference has significant implications for understanding the evolution and diversity of antibiotic resistance mechanisms in bacteria.

What is the substrate specificity of the EbrAB efflux system?

The EbrAB efflux system demonstrates resistance against several structurally diverse compounds. Experimental evidence has shown that the recombinant plasmid carrying ebrAB genes produces elevated resistance against:

  • Ethidium bromide

  • Acriflavine

  • Pyronine Y

  • Safranin O

This broad substrate specificity is characteristic of multidrug efflux pumps and indicates that EbrAB recognizes multiple structurally distinct compounds rather than a single specific substrate.

What are the recommended protocols for cloning and expressing ebrAB genes?

For successful cloning and expression of ebrAB genes, researchers should follow a methodology similar to that described in the original characterization:

  • Extract chromosomal DNA from Bacillus subtilis ATCC 9372 using standard DNA isolation protocols.

  • Design primers that flank the ebrAB operon, including appropriate restriction sites for subsequent cloning.

  • Amplify the target sequence using PCR with high-fidelity DNA polymerase.

  • Clone the amplified fragment into an appropriate expression vector.

  • Transform the recombinant plasmid into an expression host such as E. coli KAM3 (which lacks the AcrAB efflux system) to avoid interference from endogenous efflux mechanisms .

  • Confirm successful transformation through antibiotic selection, PCR verification, and DNA sequencing.

For functional expression studies, it's critical that both ebrA and ebrB genes are present and properly expressed, as neither gene alone confers resistance .

How can researchers effectively measure EbrAB-mediated drug efflux in laboratory settings?

To quantitatively assess EbrAB-mediated drug efflux, researchers can employ several complementary approaches:

  • Drug susceptibility testing: Determine minimum inhibitory concentrations (MICs) for various substrates in strains expressing or lacking the EbrAB system. This involves preparing bacterial cultures (approximately 10^5 cells/ml) and incubating them with serial dilutions of test compounds at 37°C for 24 hours, then assessing growth .

  • Energy-dependent efflux assays: Measure the active efflux of fluorescent substrates like ethidium bromide. This typically involves:

    • Loading cells with the fluorescent substrate

    • Monitoring fluorescence decrease over time after energization of cells

    • Comparing efflux rates between EbrAB-expressing strains and control strains

  • Membrane vesicle transport assays: For more direct measurement of transport activity, prepare inside-out membrane vesicles from cells expressing EbrAB and measure substrate uptake in the presence of an energy source.

What controls should be included when studying EbrAB function?

Rigorous experimental design for studying EbrAB function should include the following controls:

  • Negative controls:

    • Host cells without ebrAB genes

    • Cells expressing only ebrA or only ebrB (to demonstrate the requirement for both components)

    • Cells harboring empty vector plasmids

  • Positive controls:

    • Strains expressing well-characterized efflux pumps (e.g., EmrE from E. coli)

    • Complementation controls where ebrAB genes are reintroduced into knockout strains

  • Functional controls:

    • Metabolic inhibitors (such as carbonyl cyanide m-chlorophenylhydrazone, CCCP) to demonstrate energy dependence of efflux

    • Experiments conducted at different temperatures to assess temperature dependence

    • pH variation to determine optimal functional conditions

What structural features define the EbrAB proteins, and how do they compare to other membrane transporters?

Based on sequence analysis and structural modeling approaches similar to those used for related proteins:

EbrA and EbrB belong to the SMR family of transporters, which typically contain 4-5 transmembrane segments. Key structural features likely include:

  • Hydrophobic transmembrane domains that span the cytoplasmic membrane

  • Conserved amino acid residues that are critical for substrate recognition and transport

  • Regions involved in protein-protein interaction between EbrA and EbrB components

By comparison with other SMR family members like BesC in Borrelia burgdorferi, we can infer that these proteins likely contain conserved proline residues at key positions that facilitate sharp turns in the structure, similar to P44 and P251 in BesC . Glycine residues may also be present at positions comparable to G151 and G370 in BesC, which are situated in the turns near the closed end of the periplasmic domain .

What is known about the energy requirements and transport mechanism of the EbrAB system?

The EbrAB system, like other members of the SMR family, likely functions as a drug/H+ antiporter. This means it uses the proton motive force across the bacterial membrane to drive the efflux of toxic compounds. Evidence for energy-dependent efflux comes from studies showing elevated energy-dependent efflux of ethidium in E. coli expressing EbrAB .

The transport mechanism likely involves:

  • Binding of the substrate (e.g., ethidium bromide) to a site formed by the EbrA-EbrB complex

  • Conformational changes that are coupled to proton translocation

  • Release of the substrate to the extracellular space

  • Return of the transporter to its original conformation

Researchers investigating this mechanism should consider experiments with protonophores like CCCP to dissipate the proton gradient and confirm the energy dependence of transport.

How does the EbrAB system compare with other ethidium bromide resistance mechanisms?

The EbrAB system represents just one of several mechanisms that bacteria have evolved to resist ethidium bromide toxicity. Comparative analysis reveals several key differences:

Efflux SystemOrganismComponentsFamilySubstrate RangeUnique Features
EbrABBacillus subtilisTwo (EbrA & EbrB)SMREthidium bromide, acriflavine, pyronine Y, safranin OTwo components required for function
EmrEEscherichia coliOneSMREthidium bromide, methyl viologen, tetracyclineSingle component sufficient for function
BesABCBorrelia burgdorferiThree (BesA, BesB, BesC)RNDMultiple antibioticsTolC-like outer membrane component (BesC)
QacA/BStaphylococcus aureusOneMFSQuaternary ammonium compounds, ethidium bromideBroader substrate profile than EbrAB

This comparison highlights the unique two-component nature of EbrAB within the SMR family, which typically requires only a single component for function in other characterized systems.

What are the functional similarities and differences between EbrAB and BesABC efflux systems?

While both EbrAB and BesABC systems contribute to antimicrobial resistance, they represent different families of efflux pumps with distinct structural and functional characteristics:

Similarities:

  • Both systems contribute to multidrug resistance

  • Both are energy-dependent efflux systems

  • Both can transport ethidium bromide

Differences:

  • Structural organization: EbrAB is a two-component system belonging to the SMR family , while BesABC is a three-component system of the RND family

  • Cellular localization: EbrAB likely spans only the cytoplasmic membrane, while BesABC spans both inner and outer membranes in Borrelia burgdorferi

  • Mechanism: BesC forms channel tunnels similar to TolC in E. coli , while EbrAB likely functions through a different structural mechanism

  • Genetic organization: The genes encoding these systems are arranged differently and likely regulated by different mechanisms

How can researchers effectively compare the efficiency of different efflux systems?

To systematically compare the efficiency of different efflux systems like EbrAB and others, researchers should consider the following methodological approach:

  • Standardized expression systems:

    • Express different efflux systems in the same host strain

    • Use similar promoters and expression levels for fair comparison

    • Confirm protein expression levels using Western blotting

  • Quantitative resistance assessment:

    • Determine minimum inhibitory concentrations (MICs) for a panel of substrates

    • Calculate fold-change in resistance relative to host strains lacking efflux pumps

    • Generate comprehensive resistance profiles

  • Direct transport measurements:

    • Conduct real-time fluorescence-based efflux assays

    • Measure initial rates of transport

    • Determine kinetic parameters (Km and Vmax) for different substrates

  • Bioenergetic efficiency:

    • Assess the energy cost of efflux by measuring growth rates

    • Determine the proton/substrate stoichiometry where possible

  • Data presentation:

    • Present data in standardized formats, such as radar charts for substrate profiles

    • Use statistical analyses to determine significant differences

    • Consider machine learning approaches for pattern recognition in substrate profiles

How can the study of EbrAB contribute to our understanding of antimicrobial resistance mechanisms?

The study of EbrAB offers several important insights into antimicrobial resistance mechanisms:

  • Structural diversity: The unique two-component nature of EbrAB expands our understanding of the structural diversity within the SMR family of transporters , suggesting that resistance mechanisms may be more diverse than previously recognized.

  • Evolutionary insights: Comparing EbrAB to single-component SMR transporters may reveal evolutionary pathways through which bacteria develop and optimize efflux mechanisms.

  • Resistance spectrum: Understanding the substrate specificity of EbrAB contributes to our knowledge of how different efflux pumps recognize and transport structurally diverse compounds.

  • Resistance network interactions: Studying EbrAB alongside other resistance mechanisms in Bacillus subtilis can reveal how different resistance mechanisms interact within a bacterial cell.

  • Potential targets for inhibitors: The two-component nature of EbrAB suggests that disrupting protein-protein interactions could be an effective strategy for inhibiting efflux activity, potentially leading to new approaches for combating antimicrobial resistance.

What methodologies should researchers use to study the regulation of ebrAB gene expression?

To comprehensively investigate the regulation of ebrAB gene expression, researchers should employ a multi-faceted approach:

  • Transcriptional analysis:

    • Quantitative RT-PCR to measure ebrAB mRNA levels under different conditions

    • RNA-seq for genome-wide expression analysis

    • Promoter mapping using primer extension and 5' RACE

  • Promoter analysis:

    • Reporter gene fusions (e.g., lacZ, gfp) to monitor promoter activity

    • Site-directed mutagenesis of putative regulatory elements

    • Electrophoretic mobility shift assays (EMSAs) to identify protein-DNA interactions

  • Regulator identification:

    • Transposon mutagenesis to identify regulatory genes

    • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding sites

    • Bacterial one-hybrid or two-hybrid systems to detect protein-protein interactions

  • Environmental regulation studies:

    • Analyze expression under different stress conditions (e.g., ethidium bromide exposure, pH shifts, temperature changes)

    • Investigate the role of quorum sensing in regulation

    • Examine cross-regulation with other resistance systems

  • Post-transcriptional regulation:

    • Analysis of mRNA stability

    • Investigation of potential small regulatory RNAs

    • Study of translational efficiency

What are the implications of EbrAB research for developing strategies to combat antimicrobial resistance?

Research on EbrAB has several important implications for developing new strategies to combat antimicrobial resistance:

  • Novel inhibitor design: Understanding the structure and mechanism of EbrAB could enable the rational design of specific inhibitors that target the protein-protein interface unique to this two-component system.

  • Combination therapies: Knowledge of the substrate profile of EbrAB could inform the development of drug combinations that either bypass efflux or include efflux inhibitors alongside antimicrobial agents.

  • Resistance prediction: Genomic identification of ebrAB homologs in clinical isolates could help predict resistance patterns and guide treatment decisions.

  • Diagnostic tools: Development of rapid tests to detect the presence and expression of ebrAB genes could help in identifying resistant strains earlier.

  • Cross-resistance insights: Understanding how EbrAB confers resistance to multiple compounds informs our understanding of cross-resistance phenomena, which is crucial for antimicrobial stewardship.

What are the current technical challenges in studying the structure-function relationship of EbrAB proteins?

Several technical challenges complicate the detailed study of EbrAB structure-function relationships:

  • Membrane protein crystallization: As membrane proteins, EbrA and EbrB are challenging to crystallize for X-ray crystallography, requiring specialized approaches such as lipidic cubic phase crystallization.

  • Complex formation: The requirement for both proteins to form a functional unit adds complexity to structural studies, as both proteins must be correctly expressed, purified, and assembled.

  • Functional reconstitution: Demonstrating activity in vitro requires successful reconstitution into artificial membrane systems, which can be technically demanding.

  • Protein dynamics: Understanding the conformational changes during transport requires specialized techniques like hydrogen-deuterium exchange mass spectrometry, electron paramagnetic resonance spectroscopy, or single-molecule FRET.

  • Substrate binding sites: Identifying specific residues involved in substrate recognition often requires extensive mutagenesis coupled with functional assays.

Researchers addressing these challenges might consider collaborative approaches with structural biology specialists and employing emerging techniques like cryo-electron microscopy.

How can advanced computational methods enhance our understanding of EbrAB function?

Advanced computational methods offer powerful tools for studying EbrAB function:

  • Homology modeling: Using structures of related SMR family proteins as templates to predict the structures of EbrA and EbrB. This approach has been successfully applied to BesC modeling using OprM as a template .

  • Molecular dynamics simulations: Simulating the behavior of EbrAB in a lipid bilayer environment to predict:

    • Protein-protein interactions between EbrA and EbrB

    • Conformational changes during transport cycles

    • Substrate binding and translocation pathways

  • Machine learning approaches:

    • Predicting substrate specificity based on protein sequence

    • Identifying key structural features through pattern recognition

    • Classifying new compounds as potential substrates or non-substrates

  • Systems biology modeling:

    • Integrating efflux pump activity into whole-cell models

    • Predicting the impact of efflux on antimicrobial efficacy

    • Simulating the evolution of resistance in bacterial populations

  • Virtual screening and docking:

    • Identifying potential inhibitors that target the EbrA-EbrB interface

    • Predicting binding modes of known substrates

    • Designing substrate analogs with altered transport properties

What new methodological approaches could advance research on two-component efflux systems like EbrAB?

To push the boundaries of EbrAB research, several innovative methodological approaches could be employed:

  • Covalent coupling strategies: Developing methods to covalently link EbrA and EbrB with flexible linkers to ensure stoichiometric expression and facilitate purification while maintaining function.

  • In situ structural studies: Applying techniques such as:

    • Cryo-electron tomography to visualize EbrAB complexes in their native membrane environment

    • Solid-state NMR to study structure and dynamics in membrane bilayers

    • Mass photometry to determine complex stoichiometry

  • Single-molecule techniques:

    • Fluorescence correlation spectroscopy to study binding kinetics

    • Optical tweezers to measure forces involved in conformational changes

    • Nanopore recording to directly measure transport events

  • Synthetic biology approaches:

    • Creating chimeric proteins with other SMR family members to identify functional domains

    • Engineering orthogonal two-component systems with novel specificities

    • Developing biosensors based on EbrAB for detecting antimicrobial compounds

  • CRISPR-based technologies:

    • Using CRISPRi for fine-tuned regulation of expression

    • Developing high-throughput CRISPR screens to identify genes affecting EbrAB function

    • Applying base editing for precise mutagenesis without double-strand breaks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.