Recombinant Putative fatty-acid--CoA ligase fadD25 (fadD25)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Putative Fatty-Acid--CoA Ligase fadD25 (fadD25)

Recombinant Putative Fatty-Acid--CoA Ligase fadD25 (fadD25) is an enzyme that belongs to the fatty acyl-CoA ligase family, crucial for activating fatty acids through the creation of fatty acyl-CoA, which are essential for various metabolic pathways . Specifically, fadD25 is involved in fatty acid metabolism and lipid degradation . These enzymes, also known as fatty acyl-CoA synthetases (FACS), catalyze the initial step in fatty acid metabolism, which is the formation of fatty acyl-CoA from a fatty acid, coenzyme A (CoA), and ATP .

Function and Mechanism

FadD enzymes, including fadD25, play a vital role in intermediary metabolism by facilitating the creation of fatty acyl-CoA . This process is essential for fatty acid transport, phospholipid biosynthesis, energy generation, and protein acylation . The general reaction catalyzed by these ligases is:

Fatty acid + CoA + ATP ⇌ Acyl-CoA + AMP + PP~i~

The reaction proceeds through a two-step mechanism involving an adenylated intermediate . The enzyme unites ATP and a long-chain fatty acid in its active site. Subsequently, a negatively charged oxygen atom on the fatty acid attacks the alpha phosphate on ATP, resulting in an ATP-long chain fatty acid intermediate. Pyrophosphate then departs, yielding an AMP-long chain fatty acid molecule within the enzyme's active site. Coenzyme A enters the enzyme and another intermediate is formed, consisting of AMP-long chain fatty acid-Coenzyme A. Ultimately, two products are liberated: AMP and acyl CoA .

Role in Mycobacterium tuberculosis

In Mycobacterium tuberculosis (M. tuberculosis), FadD proteins are critical due to the high lipid content in the mycobacterial cell wall, which contributes to its pathogenicity . Specifically, the long-chain fatty acyl-CoA ligase FadD2, is associated with intrinsic pyrazinamide (PZA) and pyrazinoic acid (POA) resistance in M. tuberculosis . The loss of function of FadD2 increases the susceptibility of M. tuberculosis to PZA and POA, suggesting that inhibiting fatty acid metabolism could enhance the effectiveness of these drugs .

FadD25 and Fatty Acid Beta-Oxidation

FadD25 is believed to be involved in the fatty acid beta-oxidation cycle, a crucial process for degrading fatty acids . Beta-oxidation involves several steps, beginning with the activation of free fatty acids to their corresponding fatty acyl-CoA by FadD . Subsequent reactions, including those catalyzed by acyl-CoA dehydrogenase (FadE) and enoyl-CoA hydratase (ECH), lead to the breakdown of fatty acids into acetyl-CoA, which can then enter the citric acid cycle to produce energy .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a particular tag, please inform us; we will prioritize its implementation.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-583
Protein Length
full length protein
Target Names
fadD25
Target Protein Sequence
MSVVESSLPGVLRERASFQPNDKALTFIDYERSWDGVEETLTWSQLYRRTLNLAAQLREH GSTGDRALILAPQSLDYVVSFIASLQAGIVAVPLSIPQGGAHDERTVSVFADTAPAIVLT ASSVVDNVVEYVQPQPGQNAPAVIEVDRLDLDARPSSGSRSAAHGHPDILYLQYTSGSTR TPAGVMVSNKNLFANFEQIMTSYYGVYGKVAPPGSTVVSWLPFYHDMGFVLGLILPILAG IPAVLTSPIGFLQRPARWIQMLASNTLAFTAAPNFAFDLASRKTKDEDMEGLDLGGVHGI LNGSERVQPVTLKRFIDRFAPFNLDPKAIRPSYGMAEATVYVATRKAGQPPKIVQFDPQK LPDGQAERTESDGGTPLVSYGIVDTQLVRIVDPDTGIERPAGTIGEIWVHGDNVAIGYWQ KPEATERTFSATIVNPSEGTPAGPWLRTGDSGFLSEGELFIMGRIKDLLIVYGRNHSPDD IEATIQTISPGRCAAIAVSEHGAEKLVAIIELKKKDESDDEAAERLGFVKREVTSAISKS HGLSVADLVLVSPGSIPITTSGKIRRAQCVELYRQDEFTRLDA
Uniprot No.

Q&A

What is Recombinant Putative fatty-acid--CoA ligase fadD25 (fadD25)?

Recombinant putative fatty-acid--CoA ligase fadD25 (fadD25) is a member of the fatty acyl-CoA synthetase family, which catalyzes the ATP-dependent activation of fatty acids to their corresponding CoA thioesters. While sharing functional similarities with other fatty acid-CoA ligases like the E. coli FadD protein, fadD25 has distinct structural and functional characteristics. Unlike the 62 kDa E. coli FadD enzyme, which represents the sole fatty acyl-CoA synthetase in E. coli, fadD25 is part of a more complex system of fatty acid metabolism enzymes . The recombinant form is produced through expression of the fadD25 gene in suitable host systems, typically using specialized vectors designed for optimal protein production and purification.

How can I confirm the expression and identity of recombinant fadD25?

Confirmation of recombinant fadD25 expression and identity requires a multi-faceted approach. Western blotting with specific antibodies against fadD25 or epitope tags incorporated into the recombinant construct provides initial verification. Similar to approaches used for FADD detection, immunoblotting can reveal the expected molecular weight and expression level of the protein . Mass spectrometry analysis of tryptic digests offers a more definitive identification through peptide mass fingerprinting. Additionally, enzyme activity assays measuring the formation of fatty acyl-CoA products can confirm functional expression.

For quantitative assessment of fadD25 expression at the transcriptional level, real-time quantitative RT-PCR can be employed using gene-specific primers, with normalization to housekeeping genes such as G6pd and Hprt using the 2^(-ΔΔCT) method . DNA sequencing of the expression construct should be performed to verify the integrity of the fadD25 coding sequence, similar to the approach described for FADD cDNA verification .

What expression systems are most effective for producing functional recombinant fadD25?

  • Bacterial expression: Use low temperature (16-18°C) induction to enhance solubility and reduce inclusion body formation. Fusion tags such as MBP (maltose-binding protein) can improve solubility.

  • Yeast expression: Pichia pastoris or Saccharomyces cerevisiae systems offer improved protein folding and moderate yields.

  • Insect cell expression: Baculovirus-infected Sf9 or Hi5 cells provide higher eukaryotic processing capabilities.

  • Mammalian expression: HEK293 or CHO cells may be necessary if authentic mammalian post-translational modifications are critical.

When designing expression constructs, include appropriate purification tags (His6, FLAG, etc.) with strategic placement to avoid interference with enzyme activity. Expression levels should be monitored using methods similar to those described for FADD expression monitoring, including western blotting and functional assays .

What purification strategies yield the highest activity of recombinant fadD25?

Purification of active fadD25 requires careful consideration of protein stability and activity maintenance. The following multi-step approach typically yields high-quality enzyme:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) for His-tagged fadD25 or appropriate affinity chromatography based on the fusion tag used.

  • Intermediate purification: Ion exchange chromatography (typically anion exchange at pH 7.5-8.0).

  • Polishing: Size exclusion chromatography to remove aggregates and ensure monodispersity.

Throughout the purification process, include stabilizing agents in all buffers, such as:

  • 10-20% glycerol to prevent aggregation

  • 1-5 mM DTT or 0.5-1 mM TCEP to maintain reduced cysteine residues

  • 0.1-0.5 mM EDTA to chelate metal ions that might promote oxidation

  • Consider including substrate-like compounds at low concentrations as stabilizers

For activity retention, avoid freeze-thaw cycles and store the purified enzyme with 50% glycerol at -20°C or in small aliquots at -80°C. Activity should be measured using standardized assays before and after each purification step to monitor yield and specific activity.

What are the most reliable methods for measuring fadD25 enzymatic activity?

Accurate measurement of fadD25 activity is crucial for characterizing the enzyme and evaluating the effects of experimental manipulations. Several complementary approaches can be employed:

  • Spectrophotometric coupled assays: These continuous assays measure AMP formation coupled to NADH oxidation through auxiliary enzymes (myokinase, pyruvate kinase, and lactate dehydrogenase). The decrease in absorbance at 340 nm correlates with fadD25 activity.

  • Radiometric assays: Using [14C] or [3H]-labeled fatty acids to measure the formation of labeled acyl-CoA products offers high sensitivity and specificity.

  • HPLC-based assays: Direct measurement of CoA, AMP, or fatty acyl-CoA formation using reverse-phase HPLC provides precise quantification without interference.

  • Mass spectrometry: LC-MS/MS approaches allow direct quantification of reaction products with high sensitivity and can distinguish between similar fatty acyl-CoA species.

The choice of assay should consider sensitivity requirements, availability of equipment, and specific experimental questions. For kinetic parameter determination, initial velocity measurements should be performed under conditions where substrate consumption remains below 10% to ensure linearity.

How can I differentiate between fadD25 activity and other fatty acyl-CoA synthetases in complex samples?

Distinguishing fadD25 activity from other fatty acyl-CoA synthetases in complex biological samples requires strategic approaches:

  • Substrate specificity profiling: Exploit potential differences in chain length preference or preference for modified fatty acids to differentiate fadD25 activity.

  • Selective inhibitors: Develop or identify compounds that differentially inhibit fadD25 versus other family members.

  • Immunodepletion: Use fadD25-specific antibodies to selectively remove the enzyme from complex samples, with the reduction in activity representing the fadD25 contribution.

  • Recombinant expression of tagged fadD25: Express epitope-tagged versions in the biological system of interest to allow selective pulldown and activity measurement of the tagged enzyme.

  • Genetic approaches: In appropriate systems, CRISPR/Cas9-mediated knockout or knockdown of fadD25 can help establish its specific contribution to total fatty acyl-CoA synthetase activity.

When analyzing activity data from complex samples, carefully account for potential cofactor limitations, product inhibition, and the presence of endogenous inhibitors or activators that might differentially affect family members.

What structural domains are critical for fadD25 catalytic activity?

The catalytic function of fadD25 depends on specific structural domains that can be identified through comparative analysis with better-characterized family members like E. coli FadD. Research on related enzymes suggests that fadD25 likely contains:

  • An ATP/AMP binding domain with conserved motifs for nucleotide binding and hydrolysis.

  • A fatty acid binding pocket with hydrophobic residues that accommodate the acyl chain.

  • A CoA binding region that positions the CoA molecule for the thioesterification reaction.

  • Potential linker regions that may undergo conformational changes during catalysis, similar to the mobile region identified in E. coli FadD .

Structure-function analysis approaches include:

  • Site-directed mutagenesis of conserved residues in each domain

  • Creation of truncation mutants to identify minimal functional units

  • Domain swapping with related enzymes to identify specificity determinants

  • Conformational analysis using limited proteolysis (similar to the OmpT protease studies with E. coli FadD)

The presence of ligand-induced conformational changes, as observed with E. coli FadD upon binding of oleate or ATP , suggests that fadD25 may similarly undergo structural transitions during its catalytic cycle that are important for function.

How do post-translational modifications affect fadD25 activity?

Post-translational modifications (PTMs) can significantly modulate fadD25 enzymatic activity, localization, and stability. While specific information on fadD25 PTMs is limited, research on related enzymes suggests several potential regulatory modifications:

  • Phosphorylation: Potential phosphorylation sites can be identified using prediction tools and experimentally verified using phospho-specific antibodies, mass spectrometry, or 32P labeling. Similar to FADD phosphorylation, which regulates its non-apoptotic functions , fadD25 phosphorylation may alter its enzymatic properties or interactions.

  • Acetylation: Lysine residues in regulatory regions may undergo acetylation, potentially affecting catalytic activity or substrate binding.

  • Ubiquitination: May regulate protein stability and turnover rates.

  • SUMOylation: Could influence protein-protein interactions or subcellular localization.

Methodological approaches to study PTMs include:

  • Mass spectrometry-based PTM mapping

  • Site-directed mutagenesis of modified residues to mimic or prevent modifications

  • In vitro enzymatic assays with purified kinases, acetyltransferases, etc.

  • Inhibitor studies targeting specific PTM-adding or -removing enzymes

When evaluating the impact of PTMs, consider context-dependent effects that may vary across cell types, metabolic states, or in response to specific signaling pathways.

How can fadD25 be used as a tool for studying cellular fatty acid metabolism?

Fadd25 can serve as a valuable tool for investigating various aspects of cellular fatty acid metabolism through several innovative approaches:

  • Reporter systems: Engineered fadD25 fused to fluorescent proteins can be used to track changes in enzyme localization or expression in response to metabolic perturbations.

  • Substrate flux analysis: Overexpression of fadD25 can redirect fatty acid flux toward specific metabolic pathways, allowing examination of downstream effects.

  • Metabolic labeling: Fadd25-mediated incorporation of modified fatty acids (azide or alkyne derivatives) enables click chemistry-based visualization and enrichment of labeled lipids.

  • Interaction network mapping: Proximity labeling approaches using fadD25 fusions with BioID or APEX2 can identify proteins that associate with fadD25 in its native cellular environment.

  • Synthetic biology applications: Engineered fadD25 variants with altered substrate specificities can be used to generate novel lipid species in cells.

When designing these experimental systems, careful consideration of expression levels is critical, as overexpression may cause metabolic perturbations that affect interpretation. Controls should include catalytically inactive mutants to distinguish enzymatic effects from potential structural roles.

What role might fadD25 play in disease models and pathogenesis?

The potential involvement of fadD25 in disease processes can be investigated through complementary research approaches:

  • Expression analysis: Quantitative assessment of fadD25 transcript and protein levels in disease tissues compared to healthy controls using methods similar to those described for FADD expression analysis .

  • Genetic association studies: Evaluation of fadD25 polymorphisms or mutations in patient populations with metabolic disorders, infections, or other relevant conditions.

  • Functional consequences of disease-associated variants: Similar to studies on FADD in adipose inflammation , examining how specific fadD25 variants affect enzymatic activity, protein stability, or interaction partners.

  • Animal models: Development of fadD25 knockout, knockdown, or overexpression models to assess physiological consequences, similar to the approach used for FADD heterozygous knockout mice .

  • Therapeutic targeting: Design of specific inhibitors or activators to modulate fadD25 activity in disease models.

Research in related fatty acid metabolism enzymes suggests potential involvement in:

  • Metabolic disorders: Dysregulation of fatty acid activation and utilization

  • Inflammatory conditions: Altered lipid mediator production

  • Infectious diseases: Host-pathogen interactions involving lipid metabolism

  • Cancer metabolism: Reprogramming of fatty acid utilization pathways

Comprehensive investigation should include both in vitro biochemical approaches and in vivo studies using appropriate disease models.

What are the most common issues in recombinant fadD25 expression and how can they be resolved?

Researchers working with recombinant fadD25 frequently encounter several challenges that can be addressed through specific troubleshooting approaches:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test different promoter systems (T7, tac, AOX1, etc.)

    • Adjust induction conditions (temperature, inducer concentration, timing)

    • Screen multiple expression hosts

  • Protein insolubility:

    • Reduce expression temperature (16-18°C)

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Use solubility-enhancing fusion partners (MBP, SUMO, TrxA)

    • Add mild detergents or lipids to extraction buffers

  • Enzymatic inactivity:

    • Include essential cofactors during purification

    • Avoid harsh elution conditions in affinity chromatography

    • Test different buffer compositions for stabilization

    • Purify in the presence of substrate analogs

  • Protein degradation:

    • Include protease inhibitors in all buffers

    • Monitor sample purity and integrity by SDS-PAGE

    • Consider purification at lower temperatures

    • Identify and mutate protease-sensitive sites, similar to the OmpT-sensitive site in E. coli FadD

For each issue, a systematic approach involving small-scale optimization experiments before scaling up will save time and resources. Document all optimization attempts, including unsuccessful conditions, to build a comprehensive understanding of fadD25 behavior in your specific experimental system.

How can I address inconsistent kinetic data in fadD25 activity assays?

Variability in kinetic measurements can significantly impact the interpretation of fadD25 functional studies. These inconsistencies may arise from several sources, each requiring specific solutions:

  • Enzyme stability issues:

    • Determine protein stability under assay conditions using thermal shift assays

    • Add stabilizing agents (glycerol, reducing agents, specific ions)

    • Prepare fresh enzyme preparations or validated frozen aliquots

    • Monitor activity decay over time under assay conditions

  • Substrate-related problems:

    • Ensure fatty acid solubility by using appropriate vehicles (ethanol, DMSO, BSA)

    • Verify substrate purity using analytical techniques

    • Prepare fresh substrate solutions and avoid repeated freeze-thaw cycles

    • Consider substrate inhibition at higher concentrations

  • Assay interference:

    • Test components individually for interference with detection systems

    • Include appropriate controls for background subtraction

    • Validate assay linearity with respect to time and enzyme concentration

    • Consider matrix effects in complex biological samples

  • Data analysis challenges:

    • Apply appropriate kinetic models (Michaelis-Menten, Hill, substrate inhibition)

    • Use statistical approaches to identify and handle outliers

    • Implement global fitting for complex kinetic mechanisms

    • Validate results using multiple independent enzyme preparations

Establishing standard operating procedures for enzyme preparation, storage, and assay conditions is essential for generating reproducible kinetic data. When reporting kinetic parameters, include detailed descriptions of experimental conditions to facilitate comparison across studies.

What emerging technologies might advance our understanding of fadD25 function and regulation?

Several cutting-edge technologies hold promise for deepening our understanding of fadD25:

  • Cryo-electron microscopy (cryo-EM): This technique can reveal the detailed three-dimensional structure of fadD25, including potential conformational changes during catalysis, similar to the ligand-induced conformational changes observed in E. coli FadD .

  • Single-molecule enzymology: Direct observation of individual fadD25 molecules during catalysis can reveal transient intermediates and conformational dynamics not evident in bulk measurements.

  • Advanced genetic engineering approaches: CRISPR-Cas9-based genome editing can generate precise fadD25 variants or reporter systems in endogenous contexts, similar to genetic approaches used in FADD studies .

  • Spatiotemporal activity sensors: Development of genetically encoded sensors that report on fadD25 activity in living cells could revolutionize our understanding of its regulation and function in real-time.

  • Chemoproteomics: Activity-based protein profiling with fadD25-specific probes can map the enzyme's activity landscape across different tissues and disease states.

  • Systems biology integration: Multi-omics approaches combining transcriptomics, proteomics, and metabolomics can place fadD25 function within broader metabolic networks and regulatory circuits.

These technologies, applied individually or in combination, promise to address longstanding questions about fadD25 substrate specificity, regulation, and physiological roles in different cellular contexts.

What are the potential applications of engineered fadD25 variants in biotechnology and medicine?

Engineered fadD25 variants with modified properties offer exciting possibilities for both biotechnological and medical applications:

  • Bioproduction of high-value fatty acid derivatives:

    • Engineered fadD25 with altered substrate specificity could enable production of novel fatty acyl-CoA compounds

    • Integration into synthetic metabolic pathways for biofuels or specialty chemicals

    • Development of enzyme cascades for green chemistry applications

  • Drug discovery tools:

    • High-throughput screening platforms using fadD25 to identify modulators of fatty acid metabolism

    • Development of biosensors for fatty acid levels in biological samples

    • Target engagement assays for compounds affecting lipid metabolism

  • Therapeutic strategies:

    • Gene therapy approaches using optimized fadD25 variants to correct metabolic defects

    • Cell-based therapies with engineered fadD25 expression for treating specific metabolic conditions

    • Development of precision inhibitors or activators as targeted therapeutics

  • Diagnostic applications:

    • Engineered fadD25-based biosensors for detecting abnormal fatty acid levels in patient samples

    • Activity-based probes for imaging altered fatty acid metabolism in disease states

To realize these applications, significant research is needed to characterize the structure-function relationships of fadD25 and develop robust engineering strategies. Collaboration between enzymologists, structural biologists, synthetic biologists, and clinicians will be essential for translating basic fadD25 research into practical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.