Recombinant Putative fatty acid elongation protein 3 (elo-3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Fatty Acid Elongation

ELO-3 operates within the endoplasmic reticulum membrane and participates in the elongation cycle that adds two-carbon units to fatty acid chains. Key mechanistic insights include:

  • Catalytic Activity: Acts during the initial condensation step, combining malonyl-CoA with acyl-CoA substrates .

  • Homology: Shares structural motifs (e.g., HXXHH iron-binding domain) with yeast ELO2/3 and mammalian ELOVL enzymes .

  • Biological Relevance: Required for synthesizing VLCFAs (>C24), which are essential for sphingolipid formation and membrane integrity in C. elegans .

Research Applications

Recombinant elo-3 is primarily used to:

  1. Elucidate Elongation Mechanisms: Study substrate specificity and kinetics in VLCFA biosynthesis .

  2. Model Genetic Pathways: Investigate lipid metabolism disruptions in C. elegans mutants .

  3. Comparative Studies: Analyze functional conservation with homologs like human ELOVL7 and yeast ELO2/3 .

Technical Considerations

  • Purity and Stability: The recombinant protein is prone to degradation; repeated freeze-thaw cycles are discouraged .

  • Activity Assays: Requires reconstitution in membrane-mimetic systems due to its transmembrane nature .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
elo-3; D2024.3; Putative fatty acid elongation protein 3; 3-keto acyl-CoA synthase elo-3; Very-long-chain 3-oxoacyl-CoA synthase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
elo-3
Target Protein Sequence
MAKYDYNPKYGLENYSIFLPFETSFDAFRSTTWMQNHWYQSITASVVYVAVIFTGKKIME KYKPFQLDTPLFVWNSFLAIFSILGFLRMTPEFVWSWSAEGNSFKYSICHSSYAQGVTGF WTEQFAMSKLFELIDTIFIVLRKRPLIFLHWYHHVTVMIYTWHAYKDHTASGRWFIWMNY GVHALMYSYYALRSLKFRLPKQMAMVVTTLQLAQMVMGVIIGVTVYRIKSSGEYCQQTWD NLGLCFGVYFTYFLLFANFFYHAYVKKNNRYTEVKKDKKEKEEPVDFEILEPKEDINANI AEPSITTRSAAARRKVQKAD
Uniprot No.

Target Background

Function
Putative fatty acid elongation protein 3 (elo-3) may be involved in very long-chain fatty acid synthesis and potentially required for normal rapid growth.
Database Links

KEGG: cel:CELE_D2024.3

UniGene: Cel.13217

Protein Families
ELO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of fatty acid elongation protein 3 (elo-3) in the fatty acid elongation cycle?

Fatty acid elongation protein 3 (elo-3) belongs to the elongase family that catalyzes the first and rate-limiting step in the fatty acid elongation cycle. Like other elongases, elo-3 likely catalyzes the condensation reaction between an acyl-CoA and malonyl-CoA (the two-carbon donor) to form a 3-keto acyl-CoA. This initial reaction is fundamental to the four-step elongation cycle that occurs in the endoplasmic reticulum (ER), resulting in the extension of fatty acid chains by two carbon units per cycle .

The complete elongation cycle involves four ER-resident enzymes: elongase (like elo-3), 3-keto acyl-CoA reductase (KAR), 3-hydroxy acyl-CoA dehydratase, and trans-2,3-enoyl-CoA reductase (TER), which work sequentially to extend acyl chains, potentially up to approximately 38 carbons in length .

How does elo-3 relate to other members of the ELOVL family of proteins?

Elo-3 likely shares functional and structural similarities with the seven human ELOVL enzymes (ELOVL1-7), which share 24-57% sequence identity among themselves. Based on homology to characterized ELOVLs, elo-3 may be functionally related to ELOVL1/7 subfamily, which has been identified in various model organisms including annelids . Each elongase has distinct substrate preferences regarding acyl chain length and degrees of fatty acid unsaturation. Understanding elo-3's evolutionary relationship to other elongases helps predict its potential substrate specificities and functional roles in lipid metabolism .

What are the typical substrate specificities of elo-3, and how do they compare to other elongases?

While specific elo-3 substrate preferences may vary depending on the organism, elongases generally show distinct chain-length and saturation preferences. By comparison with characterized elongases, elo-3 may have substrate preferences similar to ELOVL7, which preferentially elongates C16-C20 acyl-CoAs with higher activity towards C18 acyl-CoAs, particularly C18:3(n-3) and C18:3(n-6) acyl-CoAs .

Alternatively, if elo-3 functions more like ELOVL5, it would display high elongation activity towards C18 and C20 polyunsaturated fatty acids (PUFAs), with lower activity towards C22 PUFAs. In contrast, ELOVL4-like enzymes can effectively convert both C20 and C22 PUFAs to longer polyenoic products up to C34 . Functional characterization studies are necessary to precisely determine elo-3's substrate profile.

What are the optimal expression systems for producing recombinant elo-3 protein?

Expressing functional recombinant elo-3 presents challenges due to its transmembrane nature and location in the endoplasmic reticulum. Based on approaches used with other elongases, several expression systems can be considered:

  • Yeast expression systems: Saccharomyces cerevisiae has been successfully used to functionally characterize elongases through heterologous expression. This system allows for in vivo activity assays by providing various fatty acid substrates and analyzing the resulting elongation products .

  • Mammalian cell lines: HEK293 or similar mammalian cell lines can be used when proper post-translational modifications are critical for protein function.

  • Insect cell systems: Baculovirus-infected insect cells (Sf9, Hi5) offer advantages for membrane protein expression.

When expressing elo-3, consider using epitope tags (His, FLAG) for purification purposes and codon optimization for the chosen expression system. Purification should employ detergent screening to identify conditions that maintain protein stability and activity .

How can researchers accurately measure elo-3 elongase activity in vitro?

Measuring elongase activity requires specialized approaches due to the membrane-bound nature of these enzymes. Methodological approaches include:

  • Fatty acid profile analysis: After providing exogenous fatty acid substrates to cells expressing recombinant elo-3, extract cellular lipids and analyze fatty acid methyl esters (FAMEs) by gas chromatography (GC) or GC-mass spectrometry (GC-MS) to detect elongation products .

  • Isotope labeling: Use deuterated or 14C-labeled fatty acid substrates to trace their incorporation and metabolism, allowing quantification of elongation products. For example, deuterated substrates like EPA-d5 or AA-d8 can be used to specifically track elongation products .

  • Microsomal assays: Isolate microsomes from cells expressing elo-3 and incubate them with acyl-CoA substrates, malonyl-CoA, and necessary cofactors. Measure the formation of elongated products using HPLC or LC-MS/MS.

  • Cell-free translation systems: These can be employed for initial functional screening while avoiding the complexities of cellular expression systems.

Appropriate controls, including known elongase knockdowns (like ELOVL5) or inhibitors, should be included to validate the specificity of the assay .

What purification strategies are most effective for obtaining pure, active recombinant elo-3?

Purifying active membrane-embedded elongases like elo-3 requires specialized approaches:

  • Detergent screening: Test a panel of detergents (DDM, LMNG, GDN) to identify optimal conditions that maintain protein stability and activity. Use thermal stability assays to assess protein folding integrity in different detergents.

  • Two-step affinity purification: Employ tandem affinity tags (e.g., His-FLAG) for sequential purification steps to achieve higher purity.

  • Size exclusion chromatography: As a final polishing step to separate aggregates and obtain homogeneous protein.

  • Lipid supplementation: Include specific lipids during purification to maintain the native-like environment for the protein.

  • Alternative solubilization approaches: Consider using SMA (styrene maleic acid) copolymers to extract elo-3 with its native lipid environment intact, potentially preserving activity.

For structural studies, reconstitution into nanodiscs or amphipols after purification can help maintain protein stability while removing excess detergent .

How do cell proliferation states affect elo-3 expression and activity?

Cell proliferation significantly impacts elongase expression and activity. Based on studies with other elongases, elo-3 regulation may follow similar patterns:

Proliferating cells generally show increased capacity to incorporate and metabolize exogenous polyunsaturated fatty acids (PUFAs) compared to resting cells. In T-cells, proliferation induces significant increases in the expression of fatty acid desaturase (FADS) 1, FADS2, and elongation of very long chain fatty acids protein (ELOVL) 5 .

The transition from resting to proliferating states likely upregulates elo-3 expression to meet the increased demand for membrane lipids and signaling molecules. When designing experiments to characterize elo-3 function, researchers should account for these proliferation-dependent effects, particularly when using cell culture models .

For accurate assessment of elo-3 activity, researchers should standardize cell proliferation states and compare expression and activity between resting and proliferating cells using quantitative PCR and fatty acid profiling techniques.

What techniques are available for studying the structure-function relationship of elo-3?

Understanding the structure-function relationship of elo-3 requires multidisciplinary approaches:

  • Site-directed mutagenesis: Targeting conserved residues identified through sequence alignment with other characterized elongases. Key residues include the histidine-box motif and lysine residues that are likely involved in catalysis.

  • Chimeric protein construction: Creating fusion proteins between elo-3 and other characterized elongases to identify domains responsible for substrate specificity.

  • Cryo-EM and X-ray crystallography: These techniques can reveal the three-dimensional structure of elo-3, particularly when complexed with substrates or product analogues. Recent advances in membrane protein structural biology make this increasingly feasible .

  • Molecular dynamics simulations: Computational approaches to model substrate binding and predict the effects of mutations on protein function.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): For mapping protein dynamics and substrate-induced conformational changes without requiring crystallization.

These approaches can help elucidate how elo-3 binds substrates and catalyzes the condensation reaction, which is crucial for developing specific modulators of elongase activity .

How does nutritional regulation affect elo-3 transcription and activity?

Elongase expression and activity are subject to nutritional regulation, which likely extends to elo-3:

Studies of elongases in various organisms show that n-3 LC-PUFA can suppress transcription of elongase genes, along with major regulators of hepatic lipid metabolism such as sterol regulatory element-binding protein-1 (SREBP-1) and liver X receptor α (LXRα) .

The transcriptional regulation of elongases can occur through direct or indirect mechanisms. LXRα can regulate elongase transcription either directly or indirectly through SREBP-1. When designing experiments to study elo-3 regulation, researchers should consider:

  • Promoter analysis: Using luciferase reporter assays to identify transcription factor binding sites in the elo-3 promoter region.

  • Nutritional intervention studies: Examining how dietary fatty acids affect elo-3 expression in model organisms.

  • Chromatin immunoprecipitation (ChIP): To confirm direct binding of transcription factors to the elo-3 promoter.

Understanding the nutritional regulation of elo-3 could provide insights into how to modulate its activity in various physiological and pathological conditions .

How does elo-3 function differ across species and what can this tell us about its evolutionary significance?

Comparative analysis of elongases across species reveals important evolutionary insights that may apply to elo-3:

In annelids like Platynereis dumerilii, six Elovl genes have been identified, with four having putative functions in LC-PUFA biosynthesis: Elovl2/5, two Elovl4 genes, and Elovl1/7 . This diversity suggests specialized functions that evolved to meet species-specific lipid requirements.

Notably, one of the Elovl4-encoding genes in P. dumerilii is remarkably long compared to other animals' homologs, suggesting potential structural adaptations that may confer unique functional properties .

To study elo-3's evolutionary significance:

  • Phylogenetic analysis: Construct evolutionary trees to determine elo-3's relationship to other elongases across species.

  • Functional complementation studies: Express elo-3 from different species in model organisms lacking endogenous elongase activity to compare functional conservation.

  • Synteny analysis: Examine gene arrangements around elo-3 loci across species to identify evolutionary patterns.

These approaches can reveal how elo-3 function has been conserved or diverged across evolutionary lineages, providing insights into its fundamental importance in lipid metabolism .

What methodologies are most effective for studying elo-3 in different model organisms?

Studying elo-3 across model organisms requires tailored methodological approaches:

  • Yeast models: S. cerevisiae lacks certain elongases, making it an excellent system for heterologous expression and functional characterization through fatty acid supplementation studies.

  • C. elegans: As a nematode, it offers powerful genetic tools, including CRISPR-Cas9 for gene editing and RNAi for knockdown studies. Lipid analysis in C. elegans typically employs GC-MS or LC-MS/MS following appropriate extraction protocols.

  • Zebrafish: Provides a vertebrate model with optical transparency for in vivo imaging, suitable for studying developmental roles of elo-3. Morpholino knockdown or CRISPR-Cas9 can be used for functional studies.

  • Mammalian cell culture: HEK293 or HepG2 cells allow for studies of human elo-3 homologs, with siRNA knockdown approaches being particularly effective .

  • Mouse models: Conditional knockout approaches using Cre-lox systems can reveal tissue-specific functions of elo-3 homologs.

When selecting a model organism, consider relevant physiological contexts and available genetic tools for manipulating elo-3 expression and activity .

What are the major technical challenges in studying membrane-bound elongases like elo-3?

Membrane-bound proteins like elo-3 present several technical challenges:

  • Expression and purification: As integral membrane proteins, elongases are difficult to express and purify in active form. The hydrophobic nature of these proteins often leads to aggregation or improper folding.

  • Functional assays: Developing reliable in vitro assays is challenging because elongases function as part of multi-enzyme complexes in the ER membrane. Reconstituting these complexes in vitro while maintaining physiological activity requires sophisticated approaches.

  • Structural studies: Obtaining high-resolution structures of membrane proteins is technically demanding. Recent advances in cryo-EM have helped, but challenges remain in sample preparation and stability.

  • Protein-lipid interactions: Elongases function within specific lipid environments, and disrupting these interactions during purification can affect activity.

Emerging technologies like native mass spectrometry, single-particle cryo-EM, and lipid nanodisc systems are helping to overcome these challenges, enabling more detailed studies of elongase structure and function .

How can RNA interference and CRISPR-Cas9 approaches be optimized for studying elo-3 function?

Gene silencing and editing technologies offer powerful tools for studying elo-3 function, but require optimization:

  • RNAi optimization:

    • Design multiple siRNA sequences targeting different regions of elo-3 mRNA

    • Validate knockdown efficiency using qPCR and western blotting

    • Consider using inducible shRNA systems for temporal control of knockdown

    • In studies of ELOVL5, knockdown significantly affected cellular monounsaturated and PUFA profiles and impaired elongation of 18- and 20-carbon PUFAs

  • CRISPR-Cas9 strategies:

    • Design multiple guide RNAs with minimal off-target effects

    • Consider using nickase variants for improved specificity

    • Employ homology-directed repair to introduce specific mutations or tags

    • Develop conditional knockout systems (e.g., floxed alleles) to circumvent embryonic lethality

    • Validate edits through sequencing and functional assays

  • Phenotypic analysis:

    • Comprehensive lipidomic profiling before and after gene editing

    • Analysis of cellular processes dependent on specific fatty acids

    • Rescue experiments with wild-type and mutant elo-3 to confirm specificity

These genetic approaches, when combined with detailed lipidomic analyses, can provide decisive insights into elo-3's role in fatty acid metabolism and cellular physiology .

What are the emerging areas of research involving elo-3 and fatty acid elongation in disease models?

Emerging research areas connecting elongases to disease mechanisms could inform future elo-3 studies:

  • Neurodegenerative diseases: Mutations in ELOVL4 cause Stargardt disease-3, spinocerebellar ataxia 34 (SCA34), and other neurological conditions. Investigating elo-3's potential role in neuronal function could reveal new disease mechanisms .

  • Metabolic disorders: Dysregulation of fatty acid elongation contributes to metabolic diseases. For example, X-linked adrenoleukodystrophy (X-ALD) involves the accumulation of very long-chain fatty acids, and modulating elongase activity may counteract harmful effects .

  • Cancer biology: Proliferating cells show enhanced capacity to incorporate and elongate fatty acids. Given that cancer cells reprogram lipid metabolism, understanding elo-3's role in this context could identify novel therapeutic targets .

  • Immunometabolism: In activated T-cells, elongase activity increases significantly, suggesting important roles in immune cell function and potentially autoimmune diseases .

  • Developmental biology: Studies in model organisms show that elongases have crucial roles in development. Investigating elo-3's function during embryogenesis could reveal new developmental mechanisms.

Advanced disease models, including patient-derived organoids and conditional knockout mice, combined with high-resolution lipidomics, will be critical for elucidating elo-3's role in these pathological contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.