Recombinant Putative G-protein coupled receptor F59B2.13 (F59B2.13)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Putative G-protein Coupled Receptor F59B2.13

This receptor is classified as a "putative" GPCR due to sequence-based predictions of its seven-transmembrane helical structure and conserved motifs typical of GPCRs . The recombinant form is produced in heterologous expression systems for biochemical and structural studies, enabling exploration of its potential signaling roles .

Expression Systems and Production Methods

Recombinant F59B2.13 has been expressed in multiple hosts, each with distinct advantages:

Host SystemAdvantagesDisadvantages
E. coliHigh yield, cost-effective Lack of post-translational modifications
Yeast/BaculovirusEukaryotic processing, moderate scalability Lower yields compared to bacterial systems
Mammalian CellsNative-like glycosylation, functional assays High cost, technical complexity

Source confirms successful expression across these platforms, though functional activity remains unverified.

Purity and Quality Assessment

  • Purity: ≥85% as determined by SDS-PAGE .

  • Validation: Relies on electrophoretic mobility and Western blotting due to the absence of ligand-binding assays .

Functional Insights and Research Findings

Despite its recombinant availability, F59B2.13 remains an orphan receptor with no identified endogenous ligands or confirmed signaling pathways. Key observations include:

  • Structural Predictions: Molecular modeling suggests interactions with Gα subunits via residues in transmembrane helices 5 and 6, akin to β2-adrenergic receptors .

  • Challenges: Common to orphan GPCRs, including low constitutive activity and ambiguous coupling to G-protein families (e.g., Gs, Gi/o) .

Potential Applications and Future Directions

  1. Deorphanization Campaigns: High-throughput screening with peptide libraries or metabolites, as demonstrated for GPR21 and GPR52 .

  2. Structural Studies: Cryo-EM or X-ray crystallography to resolve activation mechanisms, leveraging thermostabilizing mutations .

  3. Disease Modeling: Exploration of roles in nematode behavior or metabolism, given C. elegans’ utility in neurogenetic studies .

Table 1: Key Properties of Recombinant F59B2.13

PropertyDetail
Gene SourceCaenorhabditis elegans (CELE_F59B2.13)
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purity Threshold≥85% (SDS-PAGE)
Structural Features7TM domains, conserved disulfide bonds

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its inclusion in the production process.
Synonyms
F59B2.13; Putative G-protein coupled receptor F59B2.13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-428
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
F59B2.13
Target Protein Sequence
MSNNTTIPSKTATDICLTDRQMSLSVSSTEGVLIGTIIPILVLFGISGNILNLTVLLAPN LRTRSNQLLACLAVADIVSLVVILPHSMAHYETFETALWFRKFYGKYKFQIIAMTNWSIA TATWLVFVICLERLIIIKYPLSVRKQAKFFTPRNVVTIIVVTTFILTSYNHVSHACAEKL FCNGTQYHVACLGIDSERWFRNEPNPNSEFMKSVVRVAPQVNAIFVVLIPVVLVIIFNVM LILTLRQRTKLFEPSKTIRGDSQFTQLQSKTEHKVTITVTAIVTCFTITQSPSAFVTFLS SYVHRDWVTLSAICTILVVLGKALNFVLFCLSSASFRQRLLMQTKQGILRKSTRTVSMVT SSTVVVDSLPESRKKSRVAMEMIERRTSASSCLVGGNRADRTHRANSSQSMIGERMPLKE FRRGTSFV
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F59B2.13

STRING: 6239.F59B2.13

UniGene: Cel.24872

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is F59B2.13 and what is its basic characterization?

F59B2.13 is a putative G-protein coupled receptor (GPCR) found in Caenorhabditis elegans. It is a full-length protein consisting of 428 amino acids . Like other GPCRs, it is involved in signal transduction pathways, though its specific signaling mechanisms remain under investigation. Recent studies have identified it as a novel regulator in pathogen response pathways in C. elegans .

Structurally, F59B2.13 shares features common to the GPCR superfamily, which typically contain seven transmembrane domains. The protein can be recombinantly expressed with a histidine tag to facilitate purification and functional studies .

How does F59B2.13 fit within the broader GPCR classification system?

F59B2.13 belongs to the expansive GPCR superfamily, which represents the largest family of proteins involved in signal propagation. While the search results don't specify which class F59B2.13 belongs to, GPCRs are generally categorized into several major classes (A-F).

When studying F59B2.13, it's important to consider its phylogenetic relationships with other GPCRs. Research has demonstrated that pharmacological relationships (coupling selectivity and activation level) typically reflect phylogenetic relationships among G proteins . This insight can guide hypothesis formation about F59B2.13's potential coupling preferences and signaling behaviors.

What experimental approaches are recommended for initial characterization of F59B2.13?

For researchers beginning work with F59B2.13, a systematic approach is recommended:

  • Expression analysis: Assess expression patterns using techniques like RNA-seq across developmental stages or in response to various stimuli. Differential expression analysis has successfully revealed expression patterns of numerous genes in C. elegans, including those with sex-specific expression .

  • Co-expression analysis: Apply weighted gene co-expression network analysis (WGCNA) to identify genes with similar expression patterns. This approach has successfully partitioned C. elegans genes into functional modules containing between 105 to 5,747 genes .

  • Basic functional assays: Design experimental procedures to test hypotheses about F59B2.13 function by manipulating independent variables and measuring dependent variables while controlling for extraneous factors .

  • CRISPR/Cas9 modifications: Consider gene editing to create loss-of-function or gain-of-function variants. Both RNP-based and plasmid-based methods are available for C. elegans, with trade-offs between cost, simplicity, and editing efficiency .

How should experimental designs be structured to study F59B2.13 coupling with G proteins?

Investigating F59B2.13's coupling with G proteins requires careful experimental design following these methodological steps:

  • Variable definition: Clearly delineate independent variables (e.g., presence/expression level of F59B2.13) and dependent variables (e.g., activation of specific G protein subtypes) .

  • Hypothesis formulation: Develop testable hypotheses based on existing knowledge about GPCR-G protein coupling patterns. GPCRs can couple to multiple G protein families (Gs, Gi/o, Gq/11, and G12/13) .

  • Treatment design: Create experimental conditions that manipulate F59B2.13 expression or activity. Consider that approximately 75% of GPCRs activate all G proteins within the same family, while activation of only one subtype is less common .

  • Subject assignment: For in vivo studies, establish appropriate control and experimental groups following either between-subjects or within-subjects designs .

  • Measurement planning: Develop reliable methods to detect G protein activation. Consider that the current consensus coupling map identifies numerous receptors with novel couplings distributed across all G protein families .

When interpreting results, note that while phylogenetic G protein classification traditionally defines four families, this classification should be experimentally validated for F59B2.13 specifically .

What CRISPR/Cas9 strategies would be most effective for studying F59B2.13 function in C. elegans?

For CRISPR/Cas9-mediated investigation of F59B2.13, consider these methodological approaches:

  • Editing method selection:

    • RNP-based method: Offers higher editing efficiency but at higher cost. Involves pre-assembly of Cas9/sgRNA or Cas9/crRNA/tracrRNA ribonucleoprotein complex before adding repair templates .

    • Plasmid-based method: More economical but requires more preparation time and injected animals. Uses plasmids for expressing Cas9, sgRNA, and templates .

  • Selection strategy implementation: Choose an appropriate selection approach to identify successful editing events:

    • Phenotypic selection

    • PCR selection

    • Co-CRISPR method

    • Positive selection markers

  • Template design for HDR-mediated editing:

    • For precise edits, use short single-stranded DNA with 30-80 nt homology arms .

    • For larger modifications, consider double-stranded DNA templates.

  • Editing strategy selection: Based on research questions, implement:

    • Knockout strategies to assess loss-of-function phenotypes

    • Tagged constructs for localization and interaction studies

    • Point mutations to evaluate specific residue functions in signaling

This approach allows for precise genetic manipulation of F59B2.13 to evaluate its roles in various physiological and developmental processes.

How can transcriptomic analyses be leveraged to predict F59B2.13 function?

Transcriptomic analyses provide powerful approaches for predicting F59B2.13 function:

  • Differential expression analysis: Analyze RNA-seq data across different conditions, developmental stages, or tissues. This approach has successfully identified 1,751 genes with higher expression in male C. elegans .

  • Co-expression network construction: Implement weighted gene co-expression network analysis (WGCNA) to identify genes with similar expression patterns across multiple time points. In C. elegans, this method has successfully partitioned genes into functional modules associated with specific biological processes .

  • Module association with functional categories:

ModuleGenesFunctional AssociationExpression Level (Median)Significant Genes
Mod1>1,000Nervous systemVariableMultiple
Mod2>1,000Nervous systemVariableMultiple
Mod3>1,000Semen/sperm developmentVariableMultiple
Mod41,421Cuticle (7.4), Molting cycle (2.8), Cell adhesion (3.5)578492
Mod51,016Ribosome (15.8), Growth (2.6), Mitochondrion (4.4)1,3542,289
Mod65,747Cell cycle (2.4), RNA processing (2.2), Transcription (2.6)9932,028

Analyze which module F59B2.13 clusters with to predict its functional associations .

  • Integration with GO enrichment analysis: Cross-reference module membership with Gene Ontology term enrichment to further refine functional predictions .

What is known about F59B2.13's role in pathogen response pathways?

F59B2.13 has been identified as a novel regulator in pathogen response pathways in C. elegans. Unlike some other genes previously reported in response to pathogens, F59B2.13 (along with DOP-6 and FMI-1) appears to represent a novel class of GPCRs involved in immune regulation .

Methodological approaches to further characterize this role include:

  • Infection models: Challenge F59B2.13 mutant and control worms with various pathogens to assess survival rates, behavioral responses, and immune pathway activation.

  • Transcriptional profiling: Perform RNA-seq on F59B2.13 mutants under pathogen challenge to identify downstream regulated genes.

  • Pathway analysis: Investigate interactions with known immune signaling components using genetic interaction studies and phosphorylation assays.

  • Tissue-specific expression: Determine in which tissues F59B2.13 functions during immune responses using tissue-specific promoters and rescue experiments.

  • Comparative analysis: Compare F59B2.13's role with other GPCRs involved in immune regulation to establish shared or unique signaling mechanisms.

How can G protein coupling selectivity of F59B2.13 be systematically assessed?

To comprehensively characterize F59B2.13's G protein coupling selectivity, implement these methodological approaches:

  • Coupling profiling across G protein families: Test interactions with representatives from all four G protein families (Gs, Gi/o, Gq/11, and G12/13). Note that studies have revealed 38 receptors with novel couplings to 101 G proteins distributed across all families: Gs: 4, Gi/o: 15, Gq/11: 10, and G12/13: 21 .

  • Family-wide profiling: Assess coupling across all members within each family. Research indicates that approximately 73% of GPCRs promiscuously activate all members within a G protein family (Gq/11: 73%, G12/13: 66%, Gi/o: 75%, and Gs: 80%) .

  • Selectivity determination: Evaluate whether F59B2.13 exhibits selective coupling. Only a minority of receptors activate only one subtype within a family: 11 Gs, 4 Gz, 1 G14, 10 G15, 5 G12, and 10 G13-coupled receptors .

  • Correlation analysis: Calculate Pearson correlation coefficients to assess relationships between coupling profiles. Studies show strongest correlations for G proteins within the same family, with some pairs showing exceptionally high correlation: Gi1-Gi2 (0.99), GoA-GoB (0.96), and Gq-G11 (0.99) .

  • Activation level measurement: Quantify both coupling presence/absence and activation potency (log(Emax/EC50)). Both metrics have been shown to reflect phylogenetic relationships .

How should contradictory findings about F59B2.13 function be reconciled?

When facing contradictory findings regarding F59B2.13 function, implement this systematic approach:

  • Experimental design evaluation: Assess differences in experimental design between studies, particularly:

    • Variable definition and control of extraneous variables

    • Hypothesis formulation specificity

    • Treatment design and manipulation validation

    • Subject assignment methods and potential biases

    • Measurement approach precision and accuracy

  • Context specificity analysis: Consider whether differences reflect context-dependent functions, as GPCRs often exhibit different coupling patterns in different cellular environments .

  • Technical approach comparison: Evaluate whether contradictions stem from methodological differences:

    • RNP-based versus plasmid-based CRISPR/Cas9 approaches

    • Different selection or screening methods for genetic modifications

    • Varying repair template designs affecting editing outcomes

  • Statistical robustness assessment: Examine statistical approaches, sample sizes, and potential for false positives or negatives in conflicting studies.

  • Meta-analysis framework: When appropriate, apply formal meta-analysis techniques to integrate findings across multiple studies, particularly focusing on effect sizes rather than binary outcomes.

What technical challenges should researchers anticipate when expressing recombinant F59B2.13?

Researchers working with recombinant F59B2.13 should anticipate several technical challenges:

  • Expression system optimization: While E. coli has been used successfully for F59B2.13 expression , membrane proteins like GPCRs often require extensive optimization. Consider:

    • Testing multiple expression systems (bacterial, yeast, insect, mammalian)

    • Evaluating different cell compartment targeting strategies

    • Optimizing codon usage for the expression system

  • Protein solubility and stability:

    • Implement detergent screening to identify optimal solubilization conditions

    • Consider fusion partners to enhance solubility (beyond the His-tag mentioned )

    • Evaluate addition of stabilizing ligands during purification

  • Functional validation challenges:

    • Develop robust assays to confirm proper folding and functionality

    • Assess binding of putative ligands if known

    • Validate coupling to G proteins using in vitro reconstitution systems

  • Structural characterization limitations:

    • Address challenges in obtaining sufficient quantities for structural studies

    • Consider lipid environment requirements for maintaining native conformation

    • Evaluate the impact of tags on structure and function

What emerging technologies could advance F59B2.13 research?

Several emerging technologies show promise for advancing F59B2.13 research:

  • Advanced gene editing approaches: Beyond basic CRISPR/Cas9 applications, consider:

    • Base editing for precise nucleotide modifications without double-strand breaks

    • Prime editing for flexible genome engineering with reduced off-target effects

    • Conditional gene manipulation systems for temporal and spatial control

  • Single-cell transcriptomics: Apply to:

    • Identify cell populations expressing F59B2.13

    • Characterize cell-specific responses to F59B2.13 manipulation

    • Map developmental trajectories of F59B2.13-expressing cells

  • Cryo-electron microscopy: Leverage for:

    • Structural characterization of F59B2.13 alone and in complex with G proteins

    • Analysis of conformational changes during activation

    • Structure-based design of selective modulators

  • Optogenetic and chemogenetic tools: Develop for:

    • Precise temporal control of F59B2.13 activity

    • Cell-specific manipulation of signaling

    • Dissection of downstream pathway components

  • Computational approaches:

    • Molecular dynamics simulations to predict ligand binding and receptor activation

    • Machine learning for prediction of interaction partners

    • Systems biology modeling of F59B2.13-mediated signaling networks

How might understanding F59B2.13 contribute to broader research on GPCR biology?

F59B2.13 research has potential to advance several aspects of GPCR biology:

  • Evolutionary insights: As a GPCR in C. elegans, F59B2.13 offers opportunities to study evolutionary conservation and divergence of GPCR signaling mechanisms. This could help identify fundamental principles of GPCR function preserved across species.

  • Pathway integration: Studies have indicated F59B2.13's role in pathogen response , providing an opportunity to understand how GPCRs integrate into complex physiological responses. This could reveal principles applicable to other GPCRs involved in immunity across species.

  • G protein selectivity mechanisms: Investigating which G proteins couple with F59B2.13 and the structural determinants of these interactions could contribute to understanding the molecular basis of coupling selectivity, which remains incompletely understood despite extensive characterization of coupling patterns .

  • Model system advantages: C. elegans offers genetic tractability, transparent body, and well-mapped neural circuits for studying GPCR function in vivo. F59B2.13 research could establish new paradigms for studying GPCRs in their native context.

  • Drug discovery implications: While not directly translatable to human health, mechanistic insights from F59B2.13 could inform design principles for GPCR-targeted therapeutics, particularly regarding signaling bias and selectivity, which are increasingly important for developing safer drugs with fewer side effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.