Recombinant Putative glycosyltransferases (pimF)

Shipped with Ice Packs
In Stock

Description

Functional Reclassification and Role in Mycobacteria

  • Functional divergence: In M. marinum, pimF was renamed LosA after being implicated in lipooligosaccharide (LOS) biosynthesis rather than PIMs . LosA transfers caryophyllose residues to LOS precursors, a role distinct from PIM-related mannosyltransferases like PimE .

  • Species-specific roles: While M. tuberculosis pimF retains its original designation, its exact function remains unconfirmed. Genetic ablation studies suggest it may contribute to lipid metabolism or cell wall remodeling, but direct enzymatic activity toward PIMs has not been demonstrated .

Research Applications and Recombinant Production

Recombinant pimF is utilized for:

  • Antigen characterization: ELISA-based studies to investigate immune responses against M. tuberculosis .

  • Enzymatic assays: Testing putative glycosyltransferase activity using synthetic PPM or GDP-sugar donors .

  • Structural studies: Cryo-EM and molecular dynamics simulations to map substrate-binding cavities and catalytic residues .

Despite its recombinant availability, no in vitro activity toward canonical PIM substrates (e.g., Ac1PIM4) has been reported, contrasting with the well-characterized mannosyltransferase PimE .

Evolutionary and Therapeutic Implications

PimF’s homology to GT-C superfamily enzymes suggests evolutionary conservation in lipid glycosylation pathways. Key insights include:

Open Questions and Future Directions

Critical gaps remain:

  • Substrate specificity: Whether pimF acts on PIMs, LOS-like molecules, or alternative acceptors in M. tuberculosis.

  • Regulatory interactions: Potential cooperation with acyltransferases (e.g., PatA) or other glycosyltransferases in lipid modification .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Target Names
pimF
Target Protein Sequence
MRLSIVTTMYMSEPYVLEFYRRARAAADKITPDVEIIFVDDGSPDAALQQAVSLLDSDPC VRVIQLSRNFGHHKAMMTGLAHATGDLVFLIDSDLEEDPALLEPFYEKLISTGADVVFGC HARRPGGWLRNFGPKIHYRASALLCDPPLHENTLTVRLMTADYVRSLVQHQERELSIAGL WQITGFYQVPMSVNKAWKGTTTYTFRRKVATLVDNVTSFSNKPLVFIFYLGAAIFIISSS AAGYLIIDRIFFRALQAGWASVIVSIWMLGGVTIFCIGLVGIYVSKVFIETKQRPYTIIR RIYGSDLTTREPSSLKTAFPAAHLSNGKRVTSEPEGLATGNR
Uniprot No.

Q&A

What is PimF and how has its functional characterization evolved?

To characterize glycosyltransferases like PimF, researchers typically employ a combination of:

  • Genetic knockout studies to observe phenotypic changes

  • In vitro enzymatic assays with purified recombinant protein

  • Structural analysis using techniques such as X-ray crystallography or cryo-EM

  • Complementation experiments to confirm functional roles

When conducting these experiments, it is essential to consider that glycosyltransferases often function within a pathway where multiple enzymes act sequentially, making individual characterization challenging without considering the broader context.

What expression systems are most effective for producing functional recombinant PimF?

Expression of functional recombinant glycosyltransferases presents unique challenges due to their membrane association and post-translational modifications. For PimF and similar glycosyltransferases, researchers have employed several expression strategies:

  • E. coli-based expression systems: While simple to use, these often result in inclusion bodies requiring refolding protocols.

  • Mycobacterial expression systems: Provide native environment but have lower yields.

  • Mammalian cell lines: Offer appropriate post-translational modifications but are more resource-intensive.

  • Insect cell expression systems: Represent a middle ground between yield and proper folding.

Experimental approaches should include:

  • Testing multiple constructs with varying fusion tags (His, GST, MBP)

  • Optimizing solubilization conditions using different detergents

  • Inclusion of chaperones to improve folding

  • Temperature optimization during induction (typically lower temperatures of 16-20°C)

The choice of expression system should be guided by the specific experimental goals, with mammalian or insect cell systems generally preferred for structural studies requiring fully functional enzyme.

What are the structural features of PimF and related glycosyltransferases?

Glycosyltransferases including PimF share common structural features that are critical for their function:

  • Domain Organization: Most glycosyltransferases possess a similar domain structure consisting of:

    • A short cytoplasmic N-terminal tail

    • A single transmembrane domain (signal-anchor)

    • A stem region (spacer)

    • A large C-terminal catalytic domain

  • Conserved Motifs: Some glycosyltransferases contain conserved sequence motifs, such as the hexapeptide KDKKND/RDKKNE that may be involved in UDP-Gal binding .

  • Active Site Architecture: For related enzymes like PimE, structural studies have revealed distinctive binding cavities that accommodate both donor and acceptor substrates/products .

Understanding these structural features is critical for experimental design, particularly when creating truncated constructs for expression or designing site-directed mutagenesis experiments to probe function.

How can researchers effectively assess PimF substrate specificity?

Determining substrate specificity for putative glycosyltransferases like PimF requires systematic approaches:

  • In vitro enzymatic assays using:

    • Varied nucleotide-sugar donors (GDP-mannose, UDP-galactose, etc.)

    • Different acceptor substrates (glycolipids, glycoproteins)

    • Analysis of reaction products by mass spectrometry, HPLC, or TLC

  • Cell-based assays:

    • Expression in glycosylation-deficient cell lines

    • Complementation studies in knockout organisms

    • Analysis of glycan profiles before and after expression

  • Comparative analysis with structurally related enzymes:

    • PimE utilizes polyprenyl phosphate mannose (PPM) as a donor substrate

    • Similar enzymes may provide clues to PimF substrate preference

When designing substrate specificity experiments, researchers should consider both the sugar donor and acceptor preferences, as well as the potential influence of cofactors or membrane environments on enzyme activity.

What methods are available for monitoring PimF enzymatic activity?

Several complementary approaches can be employed to assess glycosyltransferase activity:

  • Radiometric assays:

    • Using radiolabeled sugar donors (e.g., [³H]-GDP-mannose)

    • Measuring transfer to acceptor substrates

    • Quantification via scintillation counting after separation

  • Mass spectrometry-based methods:

    • Direct detection of reaction products

    • Structural characterization of glycan modifications

    • Quantitative analysis of substrate conversion

  • Colorimetric/fluorometric assays:

    • Detection of released nucleotide diphosphates

    • Use of chromogenic or fluorogenic substrate analogs

    • High-throughput screening applications

  • Immunological detection:

    • Using antibodies specific to the glycan structure

    • Western blotting or ELISA-based detection

    • Flow cytometry for cell surface modifications

These methods should be selected based on the specific research question, available equipment, and the nature of the glycosyltransferase reaction being studied.

How can researchers resolve contradictory data regarding PimF's substrate specificity and function?

Contradictory findings regarding PimF function can be addressed through:

  • Comprehensive genetic approaches:

    • Generation of clean knockout strains using CRISPR-Cas9 or similar technologies

    • Complementation with wild-type and mutant variants

    • Analysis of accumulated intermediates in biosynthetic pathways

  • Multi-omics integration:

    • Lipidomics to analyze changes in glycolipid profiles

    • Proteomics to identify interaction partners

    • Transcriptomics to understand compensatory mechanisms

  • Structural biology combined with functional assays:

    • Co-crystallization with putative substrates

    • Molecular dynamics simulations to model substrate binding

    • Structure-guided mutagenesis to test hypotheses

  • In vivo labeling studies:

    • Metabolic incorporation of modified sugars

    • Pulse-chase experiments to track biosynthetic intermediates

    • Analysis of subcellular localization and trafficking

When addressing contradictory data, it is essential to carefully control experimental conditions, as glycosyltransferase activity can be significantly affected by factors such as membrane composition, pH, and the presence of specific detergents or cofactors.

What are the current approaches for studying PimF in the context of mycobacterial cell envelope biogenesis?

PimF and related glycosyltransferases play critical roles in mycobacterial cell envelope biosynthesis, which can be studied through:

  • Cell envelope integrity assays:

    • Permeability assays using hydrophobic dyes

    • Antibiotic susceptibility testing

    • Electron microscopy to visualize envelope alterations

  • Metabolic labeling of cell envelope components:

    • Incorporation of modified sugars into growing cells

    • Click chemistry-based visualization of newly synthesized components

    • Quantitative analysis of biosynthetic rates

  • Conditional gene expression systems:

    • Tetracycline-inducible promoters to control PimF expression

    • Analysis of phenotypic changes upon depletion/induction

    • Time-course studies to understand biosynthetic dynamics

  • Interaction studies within biosynthetic complexes:

    • Co-immunoprecipitation of protein complexes

    • Bacterial two-hybrid assays

    • Fluorescence resonance energy transfer (FRET) in live cells

These approaches can provide insights into how PimF functions within the broader context of mycobacterial cell envelope biogenesis, where disruption of key glycosyltransferases can lead to significant alterations in cell envelope integrity and function .

How does PimF activity integrate with other glycosylation pathways in the cell?

Recent research indicates important cross-talk between different glycosylation pathways. To investigate these relationships for PimF:

  • Glycolipidomic and glycoproteomic analyses:

    • Comprehensive profiling of glycolipids and glycoproteins

    • Comparison between wild-type and PimF-deficient cells

    • Identification of unexpected modifications or compensatory mechanisms

  • Organelle-specific glycosylation analysis:

    • Isolation of specific membrane compartments

    • Analysis of glycan distribution across cellular membranes

    • Tracking of glycosylation intermediates between compartments

  • Integration with sphingolipid biosynthesis:

    • Similar to B3GALT4, which functions in both ganglioside synthesis and GPI modification

    • Analysis of potential dual substrate specificity

    • Investigation of functional relationships between different glycoconjugate classes

  • Temporal control of glycosylation pathways:

    • Synchronization of cells to study cell cycle-dependent glycosylation

    • Stress-induced alterations in glycosylation priority

    • Developmental regulation of competing glycosylation pathways

Understanding these integrated pathways is critical, as studies have shown that some glycosyltransferases require specific lipid environments for optimal activity, such as B3GALT4 requiring lactosylceramide for efficient GPI side-chain galactosylation .

What computational approaches can predict PimF substrate specificity and catalytic mechanism?

Advanced computational methods can help predict glycosyltransferase function:

  • Homology modeling and molecular docking:

    • Generation of PimF structural models based on related enzymes

    • Docking of potential substrates to predict binding modes

    • Scoring and ranking of different substrate candidates

  • Molecular dynamics simulations:

    • Analysis of protein dynamics and conformational changes

    • Identification of substrate access pathways

    • Prediction of catalytic water positions and proton transfer routes

  • Quantum mechanics/molecular mechanics (QM/MM) studies:

    • Detailed investigation of reaction mechanism

    • Calculation of energy barriers for catalysis

    • Prediction of transition state structures

  • Machine learning approaches:

    • Training on known glycosyltransferase-substrate pairs

    • Feature extraction from protein sequences and structures

    • Prediction of novel substrates based on structural similarities

These computational approaches have successfully been applied to related glycosyltransferases like PimE, where molecular dynamics simulations identified substrate access pathways and binding dynamics .

What are the implications of PimF research for developing novel antimycobacterial therapeutics?

PimF and related glycosyltransferases represent potential targets for antimycobacterial drug development:

  • Target validation approaches:

    • Conditional knockdown to demonstrate essentiality

    • Chemical genetic screens to identify hypersensitive conditions

    • In vivo infection models to assess virulence contribution

  • Inhibitor development strategies:

    • High-throughput screening of compound libraries

    • Structure-based drug design targeting active sites

    • Transition state analog design based on catalytic mechanism

  • Physiological consequences of inhibition:

    • Effects on cell envelope integrity

    • Impact on host-pathogen interactions

    • Potential synergies with existing antimicrobials

  • Resistance mechanism assessment:

    • Frequency of resistance development

    • Characterization of compensatory pathways

    • Fitness costs associated with resistance mutations

Research has shown that genetic ablation of related enzymes like PimE leads to the accumulation of pathway intermediates (Ac₁/₂PIM₄) and deficiency in the synthesis of end products (Ac₁/₂PIM₆), resulting in significant consequences for the structural integrity of the mycobacterial cell envelope and plasma membrane . These findings suggest that targeted inhibition of specific glycosyltransferases could be a viable strategy for antimycobacterial drug development.

Table: Comparison of Key Mycobacterial Glycosyltransferases Involved in PIM Biosynthesis

EnzymeSubstrateProductDonorLocationEssential in M. tuberculosis
PimA (Rv2610c)PIPIM₁GDP-mannoseERYes
PimB' (Rv2188c)PIM₁PIM₂GDP-mannosePlasma membraneNo
PatA (Rv2611c)PIM₁/PIM₂AcPIM₁/AcPIM₂Palmitoyl-CoAPlasma membraneNo
PimEAc₁PIM₄Ac₁PIM₅PPMPlasma membraneNo*
PimF (putative)UnconfirmedUnconfirmedUnconfirmedUnconfirmedUnconfirmed

*Note: While not essential for growth in vitro, PimE deletion has significant consequences for cell envelope integrity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.