Recombinant Putative hydrolase Mb2247c (Mb2247c)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, we prioritize developing specified tags if provided during your order.
Note: While the tag type is determined during production, we prioritize developing specified tags if provided during your order.
Synonyms
BQ2027_MB2247C; Putative hydrolase Mb2247c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-520
Protein Length
Full Length of Mature Protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB2247C
Target Protein Sequence
TEEPGAGQTPGAPVVAPQQSWNSCREFIADTSEIRTARCATVSVPVDYDQPGGTQAKLAV
IRVPATGQRFGALLVNPGGPGASAVDMVAAMAPAIADTDILRHFDLVGFDPRGVGHSTPA
LRCRTDAEFDAYRRDPMADYSPAGVTHVEQVYRQLAQDCVDRMGFSFLANIGTASVARDM
DMVRQALGDDQINYLGYSYGTELGTAYLERFGTHVRAMVLDGAIDPAVSPIEESISQMAG
FQTAFNDYAADCARSPACPLGTDSAQWVNRYHALVDPLVQKPGKTSDPRGLSYADATTGT
INALYSPQRWKYLTSGLLGLQRGSDAGDLLVLADDYDGRDADGHYSNDQDAFNAVRCVDA
PTPADPAAWVAADQRIRQVAPFLSYGQFTGSAPRDLCALWPVPATSTPHPAAPAGAGKVV
VVSTTHDPATPYQSGVDLARQLGAPLITFDGTQHTAVFDGNQCVDSAVMHYFLDGTLPPT
SLRCAP
Uniprot No.
Target Background
Protein Families
Peptidase S33 family
Subcellular Location
Cell membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
