Recombinant Putative L,D-transpeptidase Mb0493 (Mb0493)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BQ2027_MB0493; L,D-transpeptidase Mb0493; LDT Mb0493
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-451
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB0493
Target Protein Sequence
MVIRVLFRPVSLIPVNNSSTPQSQGPISRRLALTALGFGVLAPNVLVACAGKVTKLAEKR PPPAPRLTFRPADSAADVVPIAPISVEVGDGWFQRVALTNSAGKVVAGAYSRDRTIYTIT EPLGYDTTYTWSGSAVGHDGKAVPVAGKFTTVAPVKTINAGFQLADGQTVGIAAPVIIQF DSPISDKAAVERALTVTTDPPVEGGWAWLPDEAQGARVHWRPREYYPAGTTVDVDAKLYG LPFGDGAYGAQDMSLHFQIGRRQVVKAEVSSHRIQVVTDAGVIMDFPCSYGEADLARNVT RNGIHVVTEKYSDFYMSNPAAGYSHIHERWAVRISNNGEFIHANPMSAGAQGNSNVTNGC INLSTENAEQYYRSAVYGDPVEVTGSSIQLSYADGDIWDWAVDWDTWVSMSALPPPAAKP AATQIPVTAPVTPSDAPTPSGTPTTTNGPGG
Uniprot No.

Target Background

Function
This protein generates 3→3 cross-links in peptidoglycan. It catalyzes the cleavage of the mDap(3)-D-Ala(4) bond of a tetrapeptide donor stem and forms a bond between the carbonyl of mDap(3) of the donor stem and the side chain of mDap(3) of the acceptor stem. The enzyme is specific for donor substrates containing a stem tetrapeptide; it cannot utilize pentapeptide stems.

Q&A

What is the biological function of L,D-transpeptidase Mb0493?

L,D-transpeptidases like Mb0493 catalyze the formation of 3→3 cross-links in bacterial peptidoglycan cell walls, distinct from the conventional 4→3 cross-links formed by penicillin-binding proteins (PBPs). These enzymes play critical roles in maintaining cell wall integrity, particularly under stress conditions. In E. coli, L,D-transpeptidases such as YcbB have been shown to facilitate the bypass of D,D-transpeptidase activity, contributing to β-lactam resistance when expressed in combination with elevated (p)ppGpp alarmone synthesis . While Mb0493 is from mycobacteria rather than E. coli, the fundamental catalytic mechanism is likely conserved, involving the formation of alternative peptidoglycan cross-links that can maintain cell wall integrity when conventional transpeptidation is inhibited.

How does Mb0493 differ from other L,D-transpeptidases?

Mb0493, as a putative L,D-transpeptidase from mycobacteria, likely exhibits structural and functional differences from homologs in other bacteria. While the core catalytic mechanism involving cysteine residues is conserved across L,D-transpeptidases, substrate specificity and regulatory mechanisms may differ. In E. coli, multiple L,D-transpeptidase genes (ycbB, ynhG, ybiS, erfK, and ycfS) have been identified , each with potentially distinct roles. Comparative sequence analysis between Mb0493 and other L,D-transpeptidases would reveal conserved domains and organism-specific variations that might correlate with differences in activity, substrate preference, or contribution to antimicrobial resistance.

What expression systems are most effective for producing recombinant Mb0493?

Based on successful approaches with other L,D-transpeptidases, E. coli expression systems using vectors with inducible promoters are generally effective for producing recombinant Mb0493. For instance, similar enzymes have been successfully expressed using the IPTG-inducible trc promoter in vectors like pTRCKm . When designing expression constructs, researchers should consider:

  • Codon optimization for E. coli if significant codon bias exists between mycobacteria and E. coli

  • Inclusion of affinity tags (His-tag, GST) for purification while ensuring these don't interfere with enzyme activity

  • Selection of expression strains lacking endogenous L,D-transpeptidases (e.g., BW25113Δ4) to prevent contamination with host enzymes

  • Careful titration of inducer concentration, as high-level production of L,D-transpeptidases can be toxic to host cells

How can researchers design experiments to investigate Mb0493's role in antimicrobial resistance?

Designing robust experiments to elucidate Mb0493's role in antimicrobial resistance requires a multi-faceted approach:

  • Gene knockout and complementation studies: Generate Mb0493 deletion mutants in the native organism using techniques like λ red recombinase for E. coli genes . Compare antimicrobial susceptibility profiles between wild-type, knockout, and complemented strains.

  • Heterologous expression: Express Mb0493 in model organisms lacking endogenous L,D-transpeptidases, similar to studies with YcbB in E. coli BW25113Δ4 .

  • Combination with stress response factors: Test Mb0493 activity in conjunction with stress response elements like RelA, which produces the alarmone (p)ppGpp. In E. coli, the combination of YcbB expression and RelA-mediated (p)ppGpp synthesis conferred broad-spectrum β-lactam resistance .

  • Minimum inhibitory concentration (MIC) determination: Establish a standardized experimental design using the following data table format:

Antimicrobial AgentConcentration Range (μg/ml)MIC Wild-type (μg/ml)MIC Mb0493 Knockout (μg/ml)MIC Mb0493 Overexpression (μg/ml)
Ampicillin0.5-256
Ceftriaxone0.5-256
Mecillinam0.5-256
Vancomycin0.5-256
  • Growth curve analysis: Monitor bacterial growth rates in the presence of sub-inhibitory antibiotic concentrations to detect subtle phenotypic effects that might not be apparent in standard MIC assays.

What are the challenges in analyzing contradictory data regarding Mb0493's enzymatic activity?

Researchers often encounter contradictory results when characterizing L,D-transpeptidase activity. To address these challenges:

  • Standardize enzyme preparation: Variations in purification methods can significantly affect enzyme activity. Document and standardize buffer composition, pH, and storage conditions.

  • Control substrate quality: The peptidoglycan substrate quality (degree of cross-linking, fragment size) can dramatically influence experimental outcomes. Use characterized substrates like purified disaccharide-tetrapeptide (GlcNAc-MurNAc-L-Ala-γ-D-Glu-DAP-D-Ala) .

  • Validate activity assays: Employ multiple complementary assays to confirm activity:

    • Mass spectrometry to detect enzyme-substrate adducts

    • HPLC analysis of reaction products

    • Spectrophotometric assays measuring release of D-alanine

  • Consider physiological context: Enzymatic activity in vitro may not reflect in vivo activity due to differences in ionic strength, pH, and absence of cellular cofactors.

  • Examine potential interacting partners: L,D-transpeptidases may interact with other peptidoglycan synthesis enzymes. In E. coli, L,D-transpeptidases work in conjunction with the glycosyltransferase activity of PBP1b and the D,D-carboxypeptidase activity of DacA .

How does the relationship between Mb0493 and peptidoglycan carboxypeptidases affect experimental design?

Recent research indicates complex relationships between L,D-transpeptidases and peptidoglycan carboxypeptidases that must be considered when designing experiments:

  • Divergent effects on antibiotic resistance: Peptidoglycan carboxypeptidases can have opposing effects on resistance to different antibiotics. In E. coli and B. subtilis, deletion of these enzymes induced sensitivity to most β-lactams but strong resistance to vancomycin .

  • LD-transpeptidase-independent functions: Some effects of peptidoglycan carboxypeptidases on antibiotic resistance are independent of L,D-transpeptidases, suggesting parallel pathways .

  • Physical interactions: Evidence suggests physical interactions between peptidoglycan carboxypeptidases and penicillin-binding proteins (PBPs) . When studying Mb0493, researchers should investigate:

    • Potential binding partners using co-immunoprecipitation

    • Effects of carboxypeptidase activity on Mb0493 function

    • Genetic interactions through double knockout studies

  • Membrane barrier considerations: The outer membrane permeability barrier significantly impacts antibiotic resistance mechanisms. This effect varies by antibiotic class, strengthening vancomycin resistance while weakening β-lactam resistance .

What are the optimal purification protocols for obtaining active recombinant Mb0493?

Purifying active recombinant Mb0493 requires careful attention to maintaining protein stability and enzymatic activity:

  • Expression conditions optimization:

    • Test multiple induction conditions (temperature, inducer concentration, duration)

    • Consider auto-induction media to reduce toxicity associated with high-level expression

    • Evaluate solubility in different E. coli strains (BL21(DE3), Rosetta, etc.)

  • Buffer composition for purification:

    • Include reducing agents (1-5 mM DTT or β-mercaptoethanol) to protect catalytic cysteine residues

    • Maintain pH between 6.0-8.0, similar to conditions used for YcbB (pH 6.0 for activity assays)

    • Consider including glycerol (10-20%) to enhance stability

  • Purification strategy:

    • Initial capture using affinity chromatography (His-tag or GST-tag)

    • Intermediate purification using ion-exchange chromatography

    • Polishing step using size-exclusion chromatography

    • Concentration using centrifugal filters with appropriate molecular weight cutoff

  • Activity verification:

    • Test enzymatic activity after each purification step

    • Verify protein folding using circular dichroism

    • Assess thermal stability using differential scanning fluorimetry

How should researchers design kinetic studies to characterize Mb0493 activity?

Designing rigorous kinetic studies for Mb0493 requires careful consideration of substrate preparation, assay conditions, and data analysis:

  • Substrate preparation:

    • Isolate natural substrates from bacterial cell walls as described for E. coli peptidoglycan

    • Consider synthetic peptide substrates representing stem peptide structures

    • Characterize substrate purity using mass spectrometry and HPLC

  • Assay development:

    • Direct measurement of transpeptidation using labeled substrates

    • Coupled enzyme assays measuring release of terminal D-alanine

    • Mass spectrometric analysis of reaction products

  • Kinetic parameter determination:

    • Measure initial rates at varying substrate concentrations

    • Determine Km, Vmax, and kcat using appropriate curve-fitting software

    • Evaluate potential product inhibition

    • Assess effects of pH, temperature, and ionic strength

  • Data reporting format:

Kinetic ParameterValueExperimental Conditions
KmpH, temperature, buffer
kcatpH, temperature, buffer
kcat/KmpH, temperature, buffer
Temperature optimumpH, substrate concentration
pH optimumTemperature, substrate concentration

What approaches can be used to study interactions between Mb0493 and β-lactam antibiotics?

Investigating interactions between Mb0493 and β-lactam antibiotics requires specialized techniques to detect binding, inhibition, and potential acylation:

  • Direct binding studies:

    • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

    • Surface plasmon resonance (SPR) to assess binding kinetics

    • Differential scanning fluorimetry to detect thermal stability shifts upon binding

  • Inactivation kinetics:

    • Monitor formation of drug-enzyme adducts using mass spectrometry, similar to approaches used with YcbB (10 μM enzyme, 100 μM β-lactams, incubated at 20°C in 100 mM sodium-phosphate buffer, pH 6.0)

    • Determine second-order rate constants for inactivation (k2/K)

    • Compare effectiveness of different β-lactam classes (penicillins, cephalosporins, carbapenems)

  • Structural studies:

    • X-ray crystallography of Mb0493 in complex with β-lactams

    • NMR studies to map binding interfaces

    • Molecular docking coupled with site-directed mutagenesis to validate binding mode

  • In vivo resistance studies:

    • Minimum inhibitory concentration (MIC) determination in strains expressing wild-type or mutant Mb0493

    • Time-kill kinetics to assess bactericidal activity

    • Selection of resistant mutants and whole-genome sequencing to identify compensatory mutations

How should researchers design experiments to investigate the physiological role of Mb0493?

Investigating the physiological role of Mb0493 requires a systematic experimental approach:

  • Gene expression analysis:

    • Determine conditions that induce Mb0493 expression (stress, stationary phase, nutrient limitation)

    • Use quantitative PCR and/or RNA-seq to measure transcriptional responses

    • Analyze promoter elements to identify regulatory factors

  • Phenotypic characterization of mutants:

    • Generate clean deletion mutants using methods similar to those described for E. coli

    • Conduct complementation studies with wild-type and site-directed mutants

    • Evaluate growth under various stress conditions (nutrient limitation, pH stress, antibiotic exposure)

  • Cell morphology and peptidoglycan analysis:

    • Examine cell shape and division using phase-contrast and electron microscopy

    • Analyze peptidoglycan composition using HPLC and mass spectrometry

    • Quantify 3→3 vs. 4→3 cross-links in wild-type and mutant strains

  • Experimental design table:

Research QuestionMethodsControlsVariables to MeasureExpected Outcomes
When is Mb0493 expressed?qPCR, RNA-seqHousekeeping genesmRNA levels under different conditionsIdentification of inducing conditions
What is the impact of Mb0493 deletion?Growth curves, microscopyWild-type, complemented strainsGrowth rate, cell morphology, stress tolerancePhenotypic consequences of gene loss
How does Mb0493 affect peptidoglycan structure?HPLC, mass spectrometryWild-type, other L,D-transpeptidase mutantsCross-link types, abundanceAlteration in peptidoglycan cross-linking

What statistical approaches are appropriate for analyzing Mb0493 activity data?

  • Experimental design considerations:

    • Determine appropriate sample sizes through power analysis

    • Include biological replicates (different bacterial cultures) and technical replicates (repeated measurements)

    • Randomize experimental order to minimize systematic errors

    • Include appropriate positive and negative controls

  • Statistical methods for comparative studies:

    • For normally distributed data: t-tests (two groups) or ANOVA with post-hoc tests (multiple groups)

    • For non-parametric data: Mann-Whitney U test (two groups) or Kruskal-Wallis with post-hoc tests (multiple groups)

    • For growth curves or time-course experiments: repeated measures ANOVA or mixed-effects models

  • Regression analysis for kinetic data:

    • Non-linear regression for enzyme kinetics (Michaelis-Menten, allosteric models)

    • Lineweaver-Burk or Eadie-Hofstee transformations for visual inspection

    • Global fitting approaches for complex models

  • Data presentation standards:

    • Report both mean/median and measures of variation (standard deviation, standard error, confidence intervals)

    • Use consistent significance levels and clearly indicate statistical tests used

    • Present raw data when possible, especially for small sample sizes

How can researchers integrate Mb0493 findings with broader peptidoglycan synthesis pathways?

Integrating Mb0493 research into the broader context of peptidoglycan synthesis requires:

  • Pathway analysis:

    • Map interactions between Mb0493 and other peptidoglycan synthesis enzymes

    • Investigate relationships with peptidoglycan glycosyltransferases, similar to interactions observed between YcbB and PBP1b in E. coli

    • Examine connections to stress response pathways, particularly (p)ppGpp-mediated responses

  • Comparative genomics approaches:

    • Analyze conservation of L,D-transpeptidases across bacterial species

    • Identify co-evolving gene pairs suggesting functional relationships

    • Compare peptidoglycan architecture across species with different complements of L,D-transpeptidases

  • Systems biology integration:

    • Develop mathematical models of peptidoglycan synthesis incorporating Mb0493 activity

    • Use transcriptomic and proteomic data to identify co-regulated genes

    • Apply metabolic flux analysis to quantify contribution to cell wall biosynthesis

  • Multi-omics data integration table:

Data TypeAnalysis MethodIntegration ApproachExpected Insights
GenomicsComparative genome analysisIdentification of synteny and gene neighborhoodsEvolutionary context of Mb0493
TranscriptomicsRNA-seq, qPCRCo-expression network analysisRegulatory relationships
ProteomicsMS-based quantificationProtein-protein interaction networksPhysical interactions and complexes
MetabolomicsLC-MS of peptidoglycan precursorsPathway enrichment analysisMetabolic consequences of Mb0493 activity

How can researchers address the challenge of substrate availability for Mb0493 studies?

Obtaining suitable substrates for L,D-transpeptidase studies presents significant challenges:

  • Natural substrate isolation:

    • Extract peptidoglycan from bacterial cell walls using established protocols

    • Purify specific fragments such as disaccharide-tetrapeptide (GlcNAc-MurNAc-L-Ala-γ-D-Glu-DAP-D-Ala)

    • Establish quality control metrics for batch consistency

  • Synthetic substrate development:

    • Design peptide mimics of stem peptides

    • Incorporate fluorescent or chromogenic reporters for activity detection

    • Validate synthetic substrates against natural counterparts

  • Commercial collaboration:

    • Partner with specialized biochemical suppliers to develop standardized substrates

    • Establish consortium approach for sharing rare or difficult-to-synthesize materials

    • Develop repository for validated substrates with standardized quality control

  • Alternative approaches:

    • Develop whole-cell assays that bypass the need for purified substrates

    • Utilize surrogate substrates that permit high-throughput screening

    • Explore computational approaches to predict substrate specificity

What novel techniques might advance understanding of Mb0493 structure-function relationships?

Emerging technologies offer new opportunities to explore L,D-transpeptidase biology:

  • Advanced structural approaches:

    • Cryo-electron microscopy to visualize enzyme-substrate complexes

    • Time-resolved crystallography to capture catalytic intermediates

    • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

  • Genetic approaches:

    • CRISPR interference for precise transcriptional control

    • Deep mutational scanning to comprehensively map functional residues

    • In vivo chemical cross-linking to identify interaction partners

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes

    • Atomic force microscopy to visualize enzyme-substrate interactions

    • Single-molecule force spectroscopy to measure bond energetics

  • Computational methods:

    • Molecular dynamics simulations to explore conformational landscapes

    • Quantum mechanics/molecular mechanics (QM/MM) to model catalytic mechanisms

    • Machine learning approaches to predict substrate specificity and inhibitor binding

How might researchers design experiments to investigate Mb0493's role in combination with other cell wall synthesis enzymes?

Understanding the synergistic relationships between L,D-transpeptidases and other cell wall enzymes requires specialized experimental approaches:

  • Combinatorial genetics:

    • Generate double and triple mutants lacking multiple L,D-transpeptidases

    • Create strains with defined combinations of glycosyltransferases and transpeptidases

    • Use synthetic genetic array analysis to identify genetic interactions

  • Reconstitution experiments:

    • Establish in vitro peptidoglycan synthesis systems with purified components

    • Systematically vary enzyme combinations to determine minimal requirements

    • Quantify peptidoglycan synthesis rates and cross-linking patterns

  • Localization studies:

    • Use fluorescent protein fusions to track co-localization of enzymes

    • Implement super-resolution microscopy to visualize enzyme complexes

    • Apply proximity labeling techniques to identify interacting partners

  • Experimental matrix for enzyme combinations:

Enzyme CombinationPeptidoglycan SynthesisCross-link FormationAntibiotic Resistance
Mb0493 alone
Mb0493 + glycosyltransferase
Mb0493 + D,D-carboxypeptidase
Mb0493 + D,D-transpeptidase
Complete enzyme set

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.