Recombinant Putative lipoprotein lprH (lprH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lprH; BQ2027_MB1453; Putative lipoprotein LprH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-228
Protein Length
Full Length of Mature Protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
lprH
Target Protein Sequence
CTESVAGRAMRATDRSSGLPTSAKPARARDLLLQDGDRAPFGQVTQSRVGDSYFTSAVPP ECSAALLFKGSPLRPDGSSDHAEAAYNVTGPLPYAESVDVYTNVLNVHDVVWNGFRDVSH CRGDAVGVSRAGRSTPMRLRYFATLSDGVLVWTMSNPRWTCDYGLAVVPHAVLVLSACGF KPGFPMAEWASKRRAQLDSQV
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Lipid-anchor.

Q&A

What is putative lipoprotein LprH and what is its significance in mycobacterial research?

LprH (Rv1418 in M. tuberculosis, Mb1453 in M. bovis) is a putative lipoprotein containing an N-terminal signal sequence and a properly positioned prokaryotic lipoprotein lipid attachment site. It belongs to a functionally diverse class of mycobacterial membrane proteins involved in host-pathogen interactions . LprH has gained significance in mycobacterial research for several reasons:

  • It can modulate immune responses through TLR2 (Toll-like receptor 2) signaling

  • It has been implicated in increasing HIV infectivity of CD4+ T cells when overexpressed in non-pathogenic mycobacteria

  • It's among the glycosylated mycobacterial proteins that play roles in M. tuberculosis survival and immunogenicity

  • Its recombinant form serves as a valuable tool for studying mycobacterial pathogenesis and host immune responses

The lprH gene has been mapped in the M. tuberculosis genome through comprehensive genomic analysis, as illustrated in the extensive genome mapping studies of M. tuberculosis H37Rv .

How is recombinant LprH typically produced for research purposes?

Recombinant LprH can be produced using several expression systems, each with distinct advantages:

Expression SystemAdvantagesTypical Applications
E. coliHigh yield, cost-effective, shorter turnaround timeStructural studies, antibody production, protein-protein interaction studies
YeastGood yields, some post-translational modificationsApplications requiring limited glycosylation
Baculovirus/Insect cellsPost-translational modifications, proper foldingFunctional studies, enzymatic assays
Mammalian cellsMost complete post-translational modificationsStudies requiring native protein conformation and activity

Most commercially available recombinant LprH is produced in E. coli systems and typically includes affinity tags (often His-tag) to facilitate purification . The recombinant protein often lacks the lipid modifications present in native LprH, which is an important consideration when interpreting experimental results.

For optimal expression, researchers have used codon-optimized sequences under the control of strong promoters (such as T7 or hsp60), and purification is typically achieved via affinity chromatography followed by size-exclusion chromatography .

How can recombinant LprH be used to study host immune responses to mycobacteria?

Recombinant LprH serves as a valuable tool for investigating host-pathogen interactions, particularly in relation to innate immune responses. Methodological approaches include:

  • Cytokine production assays: Exposing macrophages or dendritic cells to purified recombinant LprH to measure production of cytokines such as IL-10, IL-6, TNF-α, and IL-1β. This helps elucidate the inflammatory signaling pathways activated by this lipoprotein .

  • TLR2 signaling studies: Using recombinant LprH along with TLR2 inhibitors (such as OxPAPC or CLI-095) to determine the dependence of immune responses on TLR2 signaling. Comparative studies with TLR2 knockout cells can further confirm this relationship .

  • MAPK phosphorylation assessment: Western blotting to detect phosphorylation of MAPK-p38 and other signaling proteins following exposure to recombinant LprH, similar to the approach used with other mycobacterial lipoproteins . In one study, several M. tuberculosis lipoproteins including LprH were found to enhance phosphorylation of MAPK-p38 in bovine macrophages .

  • Ex vivo infectivity models: As demonstrated in research with M. smegmatis strains overexpressing M. bovis BCG lipoproteins including LprH, which showed increased HIV infectivity of CD4+ T cells isolated from peripheral blood mononuclear cells (PBMC) .

What role does LprH play in HIV co-infection models with M. tuberculosis?

Studies have revealed that LprH from M. tuberculosis complex may enhance HIV infectivity through TLR2-dependent mechanisms. The methodological approach for investigating this relationship includes:

  • Generate recombinant M. smegmatis strains overexpressing LprH from M. bovis BCG (which naturally lacks this lipoprotein)

  • Pre-treat human PBMC with these recombinant strains (typically 48-72 hours)

  • Isolate CD4+ T cells from these PBMC

  • Expose the isolated CD4+ T cells to HIV

  • Measure HIV infectivity using appropriate assays

When this methodology was employed, exposure of human PBMC to M. smegmatis strains overexpressing LprH resulted in a 1.5-fold increase in HIV infectivity of subsequently isolated CD4+ T cells (p<0.05) . This effect was diminished when TLR signaling was inhibited using OxPAPC or CLI-095, confirming the TLR2-dependent nature of this enhancement.

These findings are significant because they reveal how mycobacterial lipoproteins like LprH might contribute to the accelerated progression from HIV infection to AIDS observed in TB co-infected individuals .

How is LprH glycosylation characterized, and what is its functional significance?

LprH is among several M. tuberculosis proteins that undergo glycosylation, a post-translational modification that can affect protein function, stability, and immunogenicity. Characterization of LprH glycosylation involves:

  • Glycoprotein enrichment: Using lectin affinity chromatography (particularly ConA-Affinity Chromatography) to isolate glycoproteins from mycobacterial cultures

  • 2D electrophoresis and mass spectrometry: To separate and identify the glycoproteins

  • Bioinformatic analysis: Tools like GlycoPP can be used to identify potential glycosylation sites

Research has identified LprH among the glycoproteins of M. tuberculosis that may play roles in:

  • TLR2 agonist activity

  • Modulation of host immune responses

  • Enhanced HIV infectivity of CD4+ T cells

The functional significance of LprH glycosylation includes potential roles in:

  • Immune recognition and antigenicity

  • Protein stability in the host environment

  • Interaction with host immune receptors, particularly TLR2

As reported in one study, LprH (Rv1418) was identified among the glycoproteins in M. tuberculosis that can activate TLR2 signaling pathways and potentially increase T-cell sensitivity to HIV infection .

What experimental controls should be included when studying immune responses to recombinant LprH?

When designing experiments to study immune responses to recombinant LprH, several critical controls should be incorporated:

  • Endotoxin contamination control: Since recombinant proteins produced in E. coli may contain lipopolysaccharide (LPS) contamination, which can stimulate immune responses independently, researchers should:

    • Test preparations for endotoxin using LAL assays

    • Include polymyxin B in stimulation assays to neutralize potential LPS contamination

    • Use protein denaturation controls (heat-treated LprH) to distinguish protein-specific effects from contaminant effects

  • Expression system considerations: Since recombinant LprH produced in E. coli lacks the lipid modifications present in native mycobacterial LprH, researchers should:

    • Compare responses to recombinant LprH with those to native LprH (if available)

    • Consider using expression systems that allow for lipidation (specialized E. coli strains with lipidation machinery)

    • Acknowledge this limitation in the interpretation of results

  • Receptor specificity controls:

    • Include TLR2 blocking antibodies or inhibitors (OxPAPC, CLI-095)

    • Use cells from TLR2-knockout models when available

    • Compare responses in wild-type versus receptor-deficient cell lines

  • Cell activation controls:

    • Unstimulated cells as negative control

    • Known TLR2 agonists (e.g., Pam3CSK4) as positive control

    • PHA (50 μg/ml) stimulated cells as positive control for general cell responsiveness

  • Protein tag controls: Since recombinant LprH typically contains affinity tags (e.g., His-tag):

    • Include controls with tag-only proteins

    • Compare differently tagged versions of the same protein when possible

How does LprH compare functionally to other mycobacterial lipoproteins?

Comparative functional analysis of mycobacterial lipoproteins reveals both shared and distinct properties:

LipoproteinKey FunctionsIL-10 InductionRelative Impact on HIV InfectivityTLR2 Activation
LprH (Rv1418)TLR2 agonist, HIV co-infection modulationModerate1.5-fold increaseYes
LprFTLR2 agonist, HIV co-infection modulationHigh2.0-fold increaseStrong
LprITLR2 agonistModerate1.4-fold increaseYes
LprPTLR2 agonistHigh2.3-fold increaseStrong
LprQTLR2 agonistHigh2.0-fold increaseStrong
LprATLR2 agonist, immunomodulationHighNot specifically determinedStrong
PhoS1Phosphate transport, TLR2 agonistModerate1.7-fold increaseModerate

When comparing their effects on HIV infectivity enhancement, studies found that LprH exposure resulted in a 1.5-fold increase in HIV infectivity of CD4+ T cells (p<0.05), which was less pronounced than the effects observed with LprF (2.0-fold), LprP (2.3-fold), or LprQ (2.0-fold) .

In terms of immune modulation, LprH shares with other mycobacterial lipoproteins the ability to activate TLR2 signaling, but potentially with different downstream effects on cytokine production and immune cell function. Understanding these comparative differences is crucial for identifying specific therapeutic targets or diagnostic markers.

What are the challenges in attributing specific immunological effects to LprH versus other lipoproteins?

Several methodological challenges complicate the attribution of specific immunological effects to LprH:

  • Redundancy in mycobacterial lipoprotein functions: M. tuberculosis expresses multiple lipoproteins with overlapping functions, making it difficult to isolate the effects of LprH alone. To address this:

    • Use knockout/knockdown approaches targeting lprH specifically

    • Employ complementation studies to confirm phenotype restoration

    • Use synthetic biology approaches with expression of single lipoproteins in non-pathogenic bacteria

  • Post-translational modifications: Native mycobacterial LprH undergoes lipidation and glycosylation, which can significantly affect its immunomodulatory properties:

    • Recombinant LprH produced in E. coli lacks these modifications

    • Compare results with LprH expressed in systems that allow post-translational modifications

    • Consider chemical synthesis of lipidated peptides corresponding to key regions of LprH

  • Strain variability: Different strains of M. tuberculosis may express LprH with subtle sequence variations or at different levels:

    • Use genome and transcriptome data to assess strain-specific expression patterns

    • Consider comparative studies across clinical isolates

    • Account for strain differences when interpreting literature results

  • Host receptor polymorphisms: Variation in TLR2 and other pattern recognition receptors can affect responses to LprH:

    • Test responses in cells from different donors

    • Consider TLR2 genotyping in human studies

    • Use receptor transfection models to study specific receptor variants

  • Technical limitations in lipoprotein purification: Lipoproteins tend to form aggregates and can be difficult to purify in native form:

    • Optimize solubilization conditions

    • Consider native purification approaches

    • Validate protein conformation using biophysical methods

How might recombinant LprH be utilized in tuberculosis vaccine development?

Recombinant LprH presents several potential applications in TB vaccine development:

  • Subunit vaccine component: LprH could be included in multi-antigen subunit vaccines, potentially enhancing immunogenicity through its TLR2 adjuvant properties.

  • Adjuvant carrier: The TLR2-stimulating properties of LprH could be harnessed to enhance immune responses to other antigens when used as a carrier protein.

  • Live vector vaccine engineering: Non-pathogenic mycobacteria or other bacterial vectors expressing LprH could potentially induce protective immunity against M. tuberculosis.

  • Rational attenuation target: Understanding LprH's role in virulence could inform the development of rationally attenuated live vaccines through modification of lprH expression.

To advance these applications, researchers should:

  • Evaluate the protective efficacy of recombinant LprH in animal models

  • Assess both humoral and cell-mediated immune responses to LprH

  • Investigate potential synergies with other TB vaccine candidates

  • Optimize delivery systems for maximum immunogenicity with minimal reactogenicity

The production of recombinant LprH in systems that preserve its immunogenic properties (including appropriate glycosylation and lipidation where possible) would be crucial for these applications .

What methods are recommended for studying the structure-function relationship of LprH?

Understanding the structure-function relationship of LprH requires a multi-faceted approach:

  • Structural biology techniques:

    • X-ray crystallography of recombinant LprH (potentially with and without lipid modifications)

    • NMR spectroscopy for solution structure determination

    • Cryo-EM for visualization of LprH in membrane contexts

    • Molecular dynamics simulations to predict structural flexibility and ligand interactions

  • Functional domain mapping:

    • Generate truncated versions of LprH to identify minimal functional domains

    • Create chimeric proteins with other mycobacterial lipoproteins to map domain-specific functions

    • Use site-directed mutagenesis to identify critical amino acid residues for TLR2 activation

    • Employ peptide arrays to identify specific binding regions

  • Receptor interaction studies:

    • Surface plasmon resonance (SPR) to measure binding kinetics with TLR2

    • Co-immunoprecipitation to identify protein-protein interactions

    • FRET or BRET assays to visualize interactions in living cells

    • Crystallize LprH-TLR2 complexes to determine binding interfaces

  • Post-translational modification analysis:

    • Mass spectrometry to map glycosylation and lipidation sites

    • Generate site-specific mutants to assess the functional importance of these modifications

    • Compare native and recombinant proteins to understand the impact of these modifications

These approaches would help identify the structural features of LprH that contribute to its immunomodulatory functions and provide insights for potential therapeutic targeting or vaccine design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.