Recombinant Putative membrane protein igaA homolog (YPO0142, y3922, YP_0143)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We typically ship the format we have in stock. However, if you have a specific requirement for the format, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YPO0142; y3922; YP_0143; Putative membrane protein IgaA homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-715
Protein Length
full length protein
Species
Yersinia pestis
Target Names
YPO0142
Target Protein Sequence
MSTIVLILALLLTSLIAVGLLWWLRFRRPHPITAALPFVKLTHRKLTPEERVSIENYLRN QQNKHGFNTQPAFDSHALAASTSSTPMLVLTPQSDNVYSVTRAITRYGVASDEPNKWRYY LDSIEVHLPSAWEQYITQDNDVELIQTQTIPLVISLNGHTLNNHQSENTYQPILPSVSKN ASIRKEDSEHIELLNIRKETPEEYALHGPNGLKEACAICIALLLLFFALSGPTVTLPWLV IVAVSLTCWACWYLFRPLSEKDLREVHCLNGTPKRWGLFGESNQGQINNISLGIVDLIYP AHWGPYFVHDLGKKTHIDIYLNRQVVRQGAFLSLHDEMKMFPLQRWGKNLTLIVGSLLVL VLLLIYVPLGLPLKLSVAWLQGAQSQQVTSVAALDKMPLRIGDMLKAQGNGMCYVPPNIQ NTRGFVFTPFDCSGIYWNTASPLPQPESETIEKAAALVETINKQLHPQGSDASVNPKLAT AIEKSGMILLDDFSDIVLKTQALCSENTDCIRLKNALVNLGNAKNWSALVKRAQSGNLEG MNVLLRPISADVLENLINTAASSFVYRETHLATEALNSPPPGGFLITSDEGKQLVNHPAP TLPLFDYSALEQWRELQRLSALLLDTPFKAEGIITNITTDANGTRHIALHSEPDIVTLGR YLATSLLLLVLIFCLVVNMVLLIQRAMKNRRRMDNIQRYYDDCFNQTLTPPPFLR
Uniprot No.

Target Background

Database Links

KEGG: ype:YPO0142

STRING: 187410.y3922

Protein Families
IgaA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is IgaA and what are its key functions in bacterial systems?

IgaA (intestinal growth attenuator A), also known as GumB in some bacterial species, is a membrane protein that plays a critical role in regulating the Rcs stress response system in Enterobacterales. It functions as a major signal transducer that impacts bacterial transcriptomes and surface protein expression . The protein has a significant effect on extracellular cytotoxic protease production and attachment-associated fimbrial/pilus proteins. Research has demonstrated that IgaA/GumB influences both early and later stages of biofilm formation and is involved in controlling microbial pathogenesis .

IgaA typically contains multiple transmembrane domains with both periplasmic and cytoplasmic regions that are crucial for its function. The most accepted model suggests that IgaA exerts control at the periplasmic side through interaction with RcsF, which is altered during stress conditions . This alteration is subsequently translated to cytoplasmic regions of IgaA, affecting downstream signaling pathways.

How are IgaA homologs identified and characterized across different bacterial species?

Identification and characterization of IgaA homologs involve multiple computational and experimental approaches:

Computational Methods:

  • Sequence similarity searches using BLAST against bacterial genome databases

  • Multiple sequence alignment to identify conserved domains and motifs

  • Phylogenetic analysis to determine evolutionary relationships

  • Structural prediction using homology modeling

Experimental Methods:

  • Cloning of orthologous genes from representative species

  • Expression of heterologous IgaA proteins to test functional complementation

  • Immunoassays with tagged variants to confirm protein expression

  • Sequencing verification to confirm the absence of mutations

For example, researchers have successfully cloned and expressed IgaA orthologs from various bacterial genera including plant pathogens (D. dadantii), animal pathogens (S. flexneri and Y. enterocolitica), and endosymbionts (S. glossinidius and P. luminescens) . These heterologous IgaA variants were engineered with a Myc-tag in the C-terminus to monitor their production and were expressed from plasmids with inducible promoters, allowing for controlled expression studies .

What are the structural characteristics of IgaA and its homologs?

IgaA is a multi-domain membrane protein with several key structural features:

Key Structural Domains:

DomainLocationKey FeaturesFunctional Significance
Periplasmic DomainBetween TM segmentsContains β14-β15 sheetsInteraction with RcsF
Cytoplasmic Domain 1 (cyt1)N-terminalContains α3-β2 junctionSignal transduction
Cytoplasmic Domain 2 (cyt2)CentralContains α6 helixInteraction with RcsD
Cytoplasmic Domain 3 (cyt3)C-terminalVariable regionSpecies-specific function
Hybrid SSB-2 DomainBetween cyt1 and cyt2Contains β7 strand with R188 residueCritical for function

The protein contains multiple transmembrane (TM) segments that anchor it to the bacterial inner membrane. Structural analyses have revealed that while the periplasmic region shows some conservation across species, the cytoplasmic regions (cyt1, cyt2, and cyt3) display greater variability in sequences and structures . Critical residues identified through mutational studies include P249, R255, D287, D313, and R314, as well as the C-terminus, all of which contribute to the protein's function .

Interestingly, recombinant IgaA in which the periplasmic domain was replaced with the equivalent region of MalF still retained the ability to repress the Rcs system, suggesting that structural requirements in the periplasm might be less strict compared to the cytoplasmic domains .

What are the optimal approaches for expressing and purifying recombinant IgaA for functional studies?

Expressing and purifying recombinant IgaA presents several challenges due to its multi-transmembrane nature. The following methodological approach has proven effective:

Expression System Selection:

  • Bacterial Expression: E. coli BL21(DE3) with pBAD24 or similar arabinose-inducible vectors are preferred for controlled expression of potentially toxic membrane proteins .

  • Induction Conditions: Low temperature (16-20°C) and reduced inducer concentration (0.01-0.05% arabinose) minimize protein misfolding and aggregation.

  • Fusion Tags: C-terminal affinity tags (Myc, His6) are recommended as they allow for monitoring expression while minimally interfering with membrane insertion.

Purification Protocol:

  • Membrane fraction isolation using differential centrifugation

  • Solubilization using mild detergents (DDM or LMNG)

  • Affinity chromatography followed by size exclusion chromatography

  • Reconstitution into liposomes or nanodiscs for functional assays

To validate proper expression, immunoassays with anti-tag antibodies should be performed, followed by sequencing verification to confirm the absence of mutations . For heterologous expression studies, it's crucial to compare expression levels and membrane localization of the various IgaA orthologs to ensure fair functional comparisons.

How can researchers effectively design mutation studies to investigate IgaA function?

Designing effective mutation studies for IgaA requires a strategic approach based on evolutionary conservation and structural insights:

Mutation Strategy Development:

  • Phylogenetic-guided approach:

    • Compare IgaA sequences across bacterial families to identify highly conserved residues

    • Focus on residues that differ between complementing and non-complementing orthologs

    • Target regions showing different degrees of evolutionary conservation

  • Structure-informed targeting:

    • Prioritize residues in key functional domains based on structural predictions

    • The β7 strand that links cyt1 to cyt2 in the hybrid SSB-2 domain contains critical residues like R188

    • Mutations in cytoplasmic domains (cyt1, cyt2) typically have more profound effects than periplasmic mutations

  • Experimental validation workflow:

    • Generate point mutations using site-directed mutagenesis

    • Express mutant proteins in IgaA-depleted backgrounds

    • Assess Rcs system activity using reporter gene fusions (e.g., RcsB-regulated genes)

    • Evaluate phenotypic changes in biofilm formation, motility, and virulence

Specific mutations like R188H, T191P, and G262R have been shown to cause partial loss of function in IgaA, resulting in reduced repression of the Rcs system and attenuation of virulence . These mutations can serve as positive controls when characterizing novel mutations.

What controls should be included when studying IgaA interaction with the Rcs system components?

Robust experimental design for studying IgaA-Rcs interactions requires careful consideration of controls:

Essential Controls for IgaA-Rcs Interaction Studies:

  • Genetic Controls:

    • Wild-type IgaA expression (positive control for Rcs repression)

    • IgaA depletion strain (negative control showing Rcs activation)

    • Known partial loss-of-function mutants (e.g., R188H variant) for reference

  • Protein-Protein Interaction Controls:

    • Non-interacting membrane protein of similar size/topology

    • Anti-tag antibody controls for co-immunoprecipitation experiments

    • Competition assays with purified domains to confirm specificity

  • Functional Readout Controls:

    • Independent measurement of Rcs activation (e.g., multiple RcsB-regulated genes)

    • Measurement of indirect effects (capsule production, biofilm formation)

    • Assessment of growth conditions that naturally activate/repress Rcs

Experimental Approach Matrix:

Experiment TypePrimary ReadoutEssential ControlsPotential Pitfalls
Co-immunoprecipitationPhysical interactionNegative binding protein, Tag-only controlsDetergent effects on membrane protein complexes
Bacterial two-hybridProtein interactionEmpty vector, Positive interaction pairFalse positives due to autoactivation
Reporter gene fusionRcs system activityUninduced condition, RcsB deletionIndirect effects on gene expression
Surface plasmon resonanceBinding kineticsInactive protein variant, Concentration seriesMembrane protein reconstitution issues

A comprehensive approach should combine genetic, biochemical, and structural methods to build a complete picture of IgaA-Rcs interactions .

How does the evolutionary co-variance between IgaA and RcsC/RcsD impact cross-species complementation studies?

Evolutionary analysis reveals significant co-variation between IgaA and its interaction partners RcsC and RcsD, which has profound implications for cross-species complementation experiments:

Evolutionary Co-variance Analysis:

Phylogenetic studies support the co-evolution of IgaA with inner membrane proteins RcsC and RcsD, suggesting coordinated adaptation of these interacting components . This evolutionary relationship explains why heterologous IgaA proteins show differential ability to complement endogenous IgaA function in cross-species experiments.

When heterologous IgaA orthologs from representative species are tested in S. Typhimurium, not all are capable of repressing the host Rcs system. For example, IgaA proteins from D. dadantii and S. flexneri can functionally replace endogenous S. Typhimurium IgaA, while those from Y. enterocolitica, S. glossinidius, and P. luminescens cannot . This pattern correlates with evolutionary distance and suggests specific structural constraints in IgaA-RcsD interactions.

Methodological Approach for Co-evolutionary Studies:

  • Perform parallel phylogenetic analyses of IgaA, RcsC, and RcsD sequences

  • Identify co-varying residues using methods like mutual information analysis

  • Generate chimeric proteins swapping domains between complementing and non-complementing orthologs

  • Test functionality through Rcs repression assays in heterologous hosts

This approach has revealed that cytoplasmic regions of IgaA show greater variability than periplasmic regions, suggesting these domains may have established structural constraints specific to particular bacterial genera . These differences may prevent proper interaction with RcsD when expressed in a heterologous system like S. Typhimurium.

What are the molecular mechanisms by which IgaA senses envelope stress and transduces signals to the Rcs phosphorelay system?

The molecular mechanisms of IgaA-mediated stress sensing and signal transduction involve a complex interplay between periplasmic sensing and cytoplasmic signaling:

Signal Sensing Mechanisms:

Unlike the variable periplasmic domain, the cytoplasmic domains (cyt1, cyt2, cyt3) show greater sequence and structural divergence between species, suggesting these regions may be more critical for signaling specificity . This is supported by the observation that a recombinant IgaA with its periplasmic domain replaced by the corresponding region of MalF still represses the Rcs system .

Signal Transduction Pathway:

When envelope stress is detected:

  • Conformational changes in the periplasmic domain alter IgaA's interaction with RcsF

  • These changes propagate through the transmembrane segments to the cytoplasmic domains

  • The altered conformation of cytoplasmic domains (particularly cyt1 and cyt2) releases inhibition on RcsD

  • Free RcsD activates the RcsC-RcsD-RcsB phosphorelay, leading to RcsB phosphorylation

  • Phosphorylated RcsB regulates gene expression, altering cell surface properties and stress responses

Critical Residues and Their Functions:

Spontaneous mutations that affect IgaA function, such as R188H, T191P, and G262R, primarily map to cytoplasmic domains, particularly the β7 strand linking cyt1 to cyt2 in the hybrid SSB-2 domain . These mutations have profound effects on Rcs system repression and virulence attenuation, highlighting the importance of these regions in signal transduction.

How can advanced structural biology techniques be applied to resolve the IgaA-RcsF-RcsD interaction interface?

Resolving the complex IgaA interaction interfaces requires integration of multiple structural biology approaches:

Integrated Structural Biology Workflow:

Data Integration Strategy:

Combine low-resolution cryo-EM maps with distance constraints from XL-MS and EPR, and dynamics information from HDX-MS to generate comprehensive interaction models. Validate these models through structure-guided mutagenesis targeting predicted interface residues.

Based on current knowledge, special attention should be paid to:

  • The periplasmic region near β14-β15 sheets for IgaA-RcsF interactions

  • Cytoplasmic domains cyt1 and cyt2, particularly the α3-β2 junction and α6 helix for IgaA-RcsD interactions

  • The β7 strand in the hybrid SSB-2 domain, which contains the critical R188 residue

How can IgaA research contribute to understanding bacterial pathogenesis and developing novel antimicrobial strategies?

IgaA research provides valuable insights for understanding bacterial pathogenesis and developing antimicrobial strategies through several mechanisms:

Pathogenesis Insights:

Studies on IgaA have revealed its global impact on bacterial transcriptomes and surface proteins, directly affecting virulence factors . In Serratia marcescens, mutations in the gumB gene (IgaA homolog) lead to clear loss of extracellular cytotoxic protease production and attachment-associated fimbrial/pilus proteins . Additionally, GumB functions as a major transducer of signals affecting biofilm formation, a key virulence determinant .

The Rcs system regulated by IgaA controls critical virulence processes including:

  • Modification of surface structures affecting host recognition

  • Biofilm formation capabilities influencing persistence

  • Stress response adaptation during host colonization

  • Expression of secretion systems and effector proteins

Antimicrobial Strategy Development:

StrategyMechanismResearch ApproachPotential Advantages
IgaA InhibitorsDirect targeting of IgaA to activate RcsStructure-based drug designReduced virulence without strong selection pressure
RcsF-IgaA Interaction DisruptorsPrevent IgaA from sensing RcsFPeptide mimetics of interaction interfacesConstitutive activation of stress response
IgaA-RcsD Interface TargetingPrevent IgaA repression of RcsDFragment-based screeningPathway-specific effects
Synthetic Lethal ApproachesTarget IgaA in combination with other pathwaysGenetic interaction screeningEnhanced antimicrobial efficacy

By targeting IgaA function, researchers could potentially develop antimicrobials that specifically activate the Rcs stress response, forcing bacteria into a less virulent state rather than directly killing them. This approach might reduce selection pressure for resistance development.

Future research should focus on comparing IgaA function across different pathogens to identify conserved mechanisms that could serve as broad-spectrum targets, while also characterizing species-specific differences that might enable tailored antimicrobial approaches .

What are the methodological challenges in translating in vitro IgaA research findings to in vivo infection models?

Translating in vitro findings about IgaA to in vivo infection models presents several methodological challenges:

Key Challenges and Solutions:

  • Environmental Complexity:

    • Challenge: In vitro conditions fail to replicate the complex host environment with multiple stressors.

    • Solution: Develop improved ex vivo models that better mimic host conditions, such as organoids or tissue-engineered models that provide relevant environmental cues.

  • Temporal Regulation:

    • Challenge: IgaA-Rcs system dynamics may differ between acute laboratory conditions and persistent infections.

    • Solution: Implement time-course studies and inducible systems for conditional IgaA depletion or mutation at different infection stages.

  • Host Factor Interactions:

    • Challenge: Host immune factors may affect IgaA function or the bacterial response to IgaA modulation.

    • Solution: Use co-culture systems with immune cells and evaluate IgaA mutants in immunocompetent versus immunocompromised models.

  • Genetic Tool Limitations:

    • Challenge: Many pathogens lack sophisticated genetic tools for precise IgaA manipulation.

    • Solution: Adapt CRISPR-Cas9 systems for targeted mutagenesis in diverse bacterial species; develop broadly applicable allelic exchange methods.

  • Phenotypic Analysis Constraints:

    • Challenge: Direct observation of IgaA-dependent changes in vivo is technically difficult.

    • Solution: Develop reporter strains with fluorescent or luminescent markers linked to Rcs-regulated promoters; implement intravital microscopy techniques.

Experimental Design Considerations:

When designing in vivo experiments to study IgaA function, researchers should:

  • Include both gain-of-function (IgaA overexpression) and loss-of-function (mutation or depletion) approaches

  • Evaluate multiple infection routes and tissue types, as IgaA's role may vary by context

  • Compare acute versus chronic infection models to understand temporal dynamics

  • Incorporate systems biology approaches to capture global effects beyond direct Rcs targets

Addressing these challenges requires interdisciplinary collaboration between microbiologists, immunologists, and bioengineers to develop improved models and analytical techniques .

How does the functional divergence of IgaA across bacterial species impact cross-species complementation studies and evolutionary analysis?

The functional divergence of IgaA across bacterial species has significant implications for both complementation studies and evolutionary analyses:

Functional Divergence Patterns:

Heterologous expression studies have shown that while some IgaA orthologs can functionally replace endogenous S. Typhimurium IgaA (e.g., from D. dadantii and S. flexneri), others cannot (e.g., from Y. enterocolitica, S. glossinidius, and P. luminescens) . This pattern suggests functional divergence that correlates with evolutionary distance.

Structural analysis reveals that functionally divergent regions are not randomly distributed. While the periplasmic domain shows relative conservation (except for the β14-β15 linking region), cytoplasmic domains (cyt1, cyt2, cyt3) show greater variability . This suggests that species-specific adaptations have primarily occurred in the cytoplasmic signaling interfaces.

Implications for Complementation Studies:

The variable ability of heterologous IgaA to complement function in S. Typhimurium likely reflects:

  • Structural constraints in IgaA-RcsD interactions specific to particular bacterial genera

  • Possible differences in recognizing signaling molecules that may vary between species

  • Co-evolution of the entire Rcs system components as a functional unit

These observations highlight the importance of considering evolutionary context when interpreting complementation studies. Failed complementation does not necessarily indicate loss of function, but may reflect specialized adaptations to species-specific signaling networks.

Evolutionary Analysis Insights:

The pattern of IgaA conservation offers insights into bacterial adaptation. The observation that obligate endosymbionts like B. aphidicola or W. glossinidia have lost IgaA alongside the entire Rcs system suggests that this regulatory network becomes dispensable in stable intracellular niches . This supports the hypothesis that the IgaA-Rcs system primarily functions as an adaptive response to environmental variability.

For future evolutionary studies, researchers should:

  • Perform detailed comparative genomics of the entire Rcs regulon across species

  • Identify co-evolving residues between IgaA, RcsC, RcsD, and RcsF

  • Correlate sequence changes with ecological niches and lifestyle transitions

  • Use ancestral sequence reconstruction to trace the evolutionary trajectory of IgaA function

This approach would provide a more comprehensive understanding of how this important regulatory system has adapted to diverse bacterial lifestyles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.