Recombinant Putative membrane protein mmpL6 (mmpL6)

Shipped with Ice Packs
In Stock

Description

Role in Oxidative Stress Response

The M6 operon mitigates reactive oxygen species (ROS) generated by host immune cells or antibiotics :

  • Inducers: Triclosan, plumbagin, and quinones (e.g., juglone) upregulate the operon >30-fold via redox-sensitive promoters .

  • Mechanism: MmpL6 stabilizes intracellular redox potential by countering ROS-induced shifts, akin to N-acetyl cysteine . Strains with intact M6 survive 3–5× better under oxidative stress than truncated variants .

3.1. Functional Complementation Studies

Reintroducing the intact M6 operon into modern Mtb lineages (e.g., L3) restores oxidative stress tolerance:

StrainTCN Tolerance (μg/mL)PLB Survival (%)Source
Ancient lineage L10.5–1.080–90
Modern lineage L30.1–0.320–30
L3 + recombinant M6 operon0.8–1.270–85

TCN = triclosan; PLB = plumbagin

3.2. Macrophage Survival

In THP-1 macrophages treated with isoniazid/rifampicin:

  • L1 (intact M6) grew 3× faster than L3 (truncated M6) .

  • Recombinant M6 expression in L3 restored intracellular survival to L1 levels .

Evolutionary and Clinical Implications

  • Lineage divergence: Loss of M6 in modern lineages (L2/L3/L4) correlates with global spread, suggesting compensatory stress-response mechanisms .

  • Drug tolerance: M6-intact strains show increased tolerance to first-line antibiotics, potentially influencing multidrug-resistant TB emergence .

Regulatory Interactions

The M6 operon is regulated by:

  • Redox-sensitive promoters: Activated under oxidative stress .

  • Post-translational modifications: Potential phosphorylation by serine/threonine protein kinases (STPKs) .

Therapeutic Targeting Potential

MmpL6 is a candidate for TB drug development due to its role in:

  • Antioxidant defense: Blocking M6 could sensitize Mtb to host ROS .

  • Lipid transport: MmpL6 interacts with cell wall biosynthesis pathways, making it critical for virulence .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-397
Protein Length
full length protein
Target Names
mmpL6
Target Protein Sequence
MQGISVTGLVKRGWMVRSVFDTIDGIDQLGEQLASVTVTLDKLAAIQPQLVALLPDEIAS QQINRELALANYATMSGIYAQTAALIENAAAMGQAFDAAKNDDSFYLPPEAFDNPDFQRG LKLFLSADGKAARMIISHEGDPATPEGISHIDAIKQAAHEAVKGTPMAGAGIYLAGTAAT FKDIQDGATYDLLIAGIAALSLILLIMMIITRSLVAALVIVGTVALSLGASFGLSVLVWQ HLLGIQLYWIVLALAVILLLAVGSDYNLLLISRFKEEIGAGLNTGIIRAMAGTGGVVTAA GLVFAATMSSFVFSDLRVLGQIGTTIGLGLLFDTLVVRAFMTPSIAVLLGRWFWWPQRVR PRPASRMLRPYGPRPVVRELLLREGNDDPRTQVATHR
Uniprot No.

Q&A

What is the MmpL6 protein in Mycobacterium tuberculosis and how does it function?

MmpL6 (Mycobacterial membrane protein Large 6) belongs to the RND (Resistance-Nodulation-Cell Division) family of membrane transport proteins in Mycobacterium tuberculosis. It functions as part of the MmpS6-MmpL6 (M6) operon that plays a critical role in oxidative stress management .

Unlike other characterized MmpL proteins that primarily transport specific lipid substrates across the cell membrane, MmpL6 appears specialized for oxidative stress response. The protein is upregulated by oxidative stress conditions and contributes to the ability of virulent, modern epidemic strains of M. tuberculosis to resist this stress . Research indicates that the M6 operon effectively changes intracellular redox potential in M. tuberculosis when exposed to oxidative stress-inducing compounds like triclosan and plumbagin .

How is the MmpS6-MmpL6 operon organized, and how does genomic variation affect its function?

The MmpS6-MmpL6 (M6) operon consists of two genes:

  • MmpS6 (Rv1557): A smaller gene encoding the MmpS6 protein

  • MmpL6 (Rv1557 continued): A larger gene encoding the MmpL6 protein

An important evolutionary aspect of this operon is its variable presence across M. tuberculosis lineages. The complete, functional M6 operon is present in ancient M. tuberculosis lineages (L1), while modern lineages (L3, L4) have a partial deletion that includes most of the MmpS6 gene and approximately two-thirds of the MmpL6 gene . This deletion is part of the TbD1 region absence that characterizes modern M. tuberculosis strains.

The genomic structure can be analyzed through:

  • PCR amplification of the M6 region

  • Whole genome sequencing to identify specific polymorphisms

  • Microarray detection to identify transposon insertion sites in the M6 locus

This genomic variation directly impacts function - ancient lineages with complete M6 operons demonstrate superior resistance to oxidative stress compared to modern lineages with the partial operon .

What experimental methods can be used to study MmpL6 expression and regulation?

Several methodologies have been developed and applied to study MmpL6 expression:

Promoter Probe Systems

Researchers have developed novel promoter-probe luminescent systems to monitor M6 expression. For example:

  • Autoluminescent reporter systems that can detect induction of the M6 promoter in response to environmental stimuli

  • High-throughput chemical screening approaches that identified several molecules activating M6 expression

Microarray Detection

Custom microarrays containing oligonucleotides corresponding to transposon insertion junctions have been used to track mutants with insertions in the M6 locus:

Method ComponentDetails
Probe preparationFluorescent labeling (Cy3 or Cy5) of PCR products
ControlsPositive controls using equimolar mixtures of oligonucleotides
ReplicationMultiple spots of each oligonucleotide as internal controls
AnalysisCustom programs using statistical R language for data analysis

Redox-Sensing Systems

To understand the functional role of M6 in oxidative stress:

  • Redox-sensing GFP systems to monitor changes in cellular redox state

  • Measurement of intracellular redox potential changes when exposed to stress-inducing compounds like triclosan or plumbagin

How does the MmpS6-MmpL6 operon contribute to oxidative stress resistance in M. tuberculosis?

The M6 operon provides a significant survival advantage to M. tuberculosis under oxidative stress conditions through multiple mechanisms:

  • Redox Potential Modulation: The expression of the complete M6 operon effectively prevents shifts in intracellular redox potential caused by oxidative stress agents. This function is similar to adding powerful ROS-quenching agents like N-acetyl cysteine .

  • Enhanced Antibiotic Tolerance: Lineage 1 (L1) strains with functional M6 operons show enhanced survival in macrophages treated with isoniazid (INH) and rifampicin compared to modern lineages (L3) lacking the complete operon. This is significant because both antibiotics induce oxidative stress as part of their bactericidal activity .

  • Stress-Induced Expression: The M6 operon shows increased expression in response to specific oxidative stress-inducing compounds:

Inducing AgentsM6 Expression Response
TriclosanStrong induction
Plumbagin and other quinonesStrong induction
Chlorinated diphenolicsStrong induction
  • Functional Complementation: Experimental expression of the complete M6 locus in modern lineages (L3, L4) is sufficient to enhance their tolerance to triclosan and plumbagin-induced killing, confirming the direct role of this operon in stress mitigation .

What are the evolutionary implications of the MmpS6-MmpL6 operon variation across M. tuberculosis lineages?

The differential presence of a functional M6 operon across M. tuberculosis lineages raises important evolutionary questions:

  • Lineage Distribution: The complete M6 operon exists in ancient lineages (L1) but is partially deleted in modern lineages (L3, L4). This deletion is part of the TbD1 region that differentiates modern from ancient strains .

  • Stress Adaptation Trade-offs: Despite the apparent advantage of having a complete M6 operon for oxidative stress resistance, modern lineages have evolved without it, suggesting either:

    • Development of compensatory mechanisms to handle oxidative stress

    • Possible fitness costs associated with maintaining the complete operon under certain conditions

    • Different ecological niches or transmission dynamics that altered selection pressures

  • Strain-Specific Survival: The functional implications of this evolutionary difference are evident in experimental systems:

M. tuberculosis StrainM6 Operon StatusResponse to Oxidative Stress
Lineage 1 (ancient)Complete, functionalEnhanced tolerance to triclosan, plumbagin, and antibiotics
Lineage 3, 4 (modern)Partially deletedMore susceptible to oxidative stress
Modern strains with introduced complete M6Artificially completeRestored tolerance to oxidative stress
  • Genetic Markers: Specific SNPs in mmpL6 and mmpS6 genes have been identified as markers that can distinguish between mycobacterial species and lineages, with at least five novel SNPs reported: gyrB520 (A→G), gyrB1721 (T→C), leuS1064 (A→T), mmpL6486 (T→C), and mmpS6334 (C→G) .

How can researchers generate and work with recombinant MmpL6 protein?

Working with recombinant MmpL6 requires specialized approaches due to its nature as a membrane protein:

Expression Systems

  • Vector Selection: For membrane proteins like MmpL6, specialized expression vectors containing strong promoters (such as T7) and appropriate fusion tags (His, MBP, or GST) are recommended.

  • Host Selection: Expression hosts optimized for membrane proteins should be utilized:

    • E. coli strains C41(DE3) or C43(DE3) designed for membrane protein expression

    • Mycobacterial expression systems using M. smegmatis for homologous expression

Purification Strategies

Membrane proteins require detergent-based extraction and purification:

  • Membrane Isolation: Differential centrifugation to isolate bacterial membranes containing MmpL6

  • Solubilization: Critical step using appropriate detergents:

    • n-Dodecyl β-D-maltoside (DDM)

    • Lauryl maltose neopentyl glycol (LMNG)

    • Optimization of detergent:protein ratios is essential

  • Purification: Typically employing affinity chromatography followed by size exclusion chromatography

Functional Assays

After purification, several approaches can verify functional integrity:

  • Reconstitution in liposomes to assess transport activity

  • Binding assays with potential substrates

  • Structural studies using cryo-EM or X-ray crystallography

What methods can be used to identify and characterize MmpL6 knockout or mutant strains?

Several approaches have been developed to generate and characterize MmpL6 mutants:

Generation of Mutants

  • Transposon Mutagenesis: Random insertion of transposons followed by screening for insertions in the mmpL6 gene. This approach can generate specific insertion mutants like those documented in microarray studies (e.g., mutant H293 with insertion at position 921 in mmpL6) .

  • Targeted Gene Deletion: Homologous recombination techniques to specifically delete part or all of the mmpL6 gene.

  • Strain Selection: Natural lineage differences can be exploited by comparing ancient (L1) strains with complete M6 operons to modern (L3, L4) strains with partial deletions .

Characterization Methods

  • High-throughput Microarray Detection:

    • Custom microarrays containing oligonucleotides corresponding to transposon insertion sites

    • Comparison of mutant pools before and after selective conditions

    • Statistical analysis to determine attenuation levels

  • Stress Survival Assays:

    • Growth curves in the presence of oxidative stress-inducing compounds

    • Comparison of MIC values between wild-type and mutant strains

    • Intracellular survival in macrophages with or without antibiotic treatment

  • Redox State Assessment:

    • Measurement of changes in cellular redox potential using redox-sensitive GFP

    • Determination of how M6 mutations affect redox homeostasis under stress conditions

How does MmpL6 compare to other MmpL proteins in M. tuberculosis?

M. tuberculosis contains 13 MmpL proteins (MmpL1-13) with varying functions. MmpL6 has several distinctive features:

Functional Comparison

MmpL ProteinKnown/Putative FunctionAttenuation in Mouse Model
MmpL1UnknownNo
MmpL2UnknownNo
MmpL4Siderophore exportYes
MmpL5Siderophore export; drug effluxYes
MmpL6Oxidative stress responseNo in aerosol model
MmpL7PDIM transportYes
MmpL8SL-1 transportYes
MmpL9UnknownNo
MmpL10DAT/PAT transportYes in IV model only
MmpL11Mycolic acid transportYes
MmpL12UnknownNo

Structural Features

Like other MmpL proteins, MmpL6 likely has:

  • Multiple transmembrane domains

  • Periplasmic domains that may interact with MmpS6

  • Substrate binding domains specific to its function

Evolutionary Context

MmpL6 is distinctive in its evolutionary history:

  • Part of the TbD1 region that is deleted in modern M. tuberculosis lineages

  • Contains lineage-specific polymorphisms that can serve as genetic markers

  • Shows specialized adaptation to oxidative stress response rather than specific lipid transport

What is known about the transcriptional regulation of the MmpS6-MmpL6 operon?

The transcriptional regulation of the M6 operon involves several key aspects:

  • Promoter Activity: The M6 promoter is functional even in modern M. tuberculosis lineages that contain a partial deletion of the operon, indicating that the upstream regulatory mechanisms remain intact despite the deletion of portions of the coding regions .

  • Stress-Responsive Induction: The M6 promoter shows increased activity in response to specific compounds identified through high-throughput screening:

    • Quinones

    • Triclosan

    • Chlorinated diphenolics like niclosamide

  • Oxidative Stress Sensing: The induction of M6 expression correlates with compounds that alter the intracellular redox potential, suggesting that the regulatory mechanism responds to changes in cellular redox state rather than to specific molecular structures .

  • Expression During Infection: While basal expression of genes like mpt70 and mpt83 in M. tuberculosis is low, their expression is strongly induced after macrophage infection under reducing conditions. This parallels the behavior of the M6 operon, suggesting shared regulatory mechanisms responding to the intracellular environment .

  • Genetic Regulatory Elements: The genomic context of the M6 operon includes several neighboring genes involved in stress response, suggesting potential co-regulation as part of a larger stress response network .

What role might MmpL6 play in antibiotic resistance mechanisms in M. tuberculosis?

The M6 operon contributes to antibiotic tolerance through several potential mechanisms:

  • Enhanced Survival Under Antibiotic Stress: Ancient lineage strains (L1) with functional M6 operons show significantly better survival in macrophages treated with isoniazid (INH) and rifampicin compared to modern lineages (L3). Both antibiotics are known to exert part of their bactericidal effect through oxidative stress induction .

  • Direct Anti-Oxidative Function: By preventing shifts in cellular redox potential, the M6 operon may directly counteract the oxidative component of antibiotic killing mechanisms:

AntibioticOxidative ComponentPotential M6 Mediation
IsoniazidGenerates reactive oxygen speciesPrevents redox potential shift
RifampicinInduces oxidative stress in macrophagesCounters host-derived oxidative damage
Other TB drugsVarious oxidative mechanismsGeneral oxidative stress protection

What methodological approaches can be used to study interactions between MmpL6 and other cellular components?

Understanding MmpL6 interactions requires specialized techniques due to its membrane protein nature:

Protein-Protein Interaction Methods

  • Bacterial Two-Hybrid Systems: Modified for membrane proteins to detect interactions between MmpL6 and potential partners like MmpS6.

  • Co-Immunoprecipitation: Using antibodies against tagged versions of MmpL6 to pull down interacting proteins, similar to studies showing MmpL4-MmpS4 periplasmic interactions .

  • Cross-Linking Studies: Chemical cross-linking followed by mass spectrometry to identify proteins in close proximity to MmpL6.

Genetic Interaction Analyses

  • Synthetic Lethality Screens: Identifying genes whose deletion is tolerated alone but lethal when combined with mmpL6 deletion.

  • Suppressor Mutation Analysis: Screening for mutations that restore function in M6-deficient strains.

  • Transcriptomic Analysis: RNA-seq to identify genes co-regulated with the M6 operon under oxidative stress conditions.

Structural Biology Approaches

  • Cryo-Electron Microscopy: To determine the structure of MmpL6 and its complexes.

  • Molecular Dynamics Simulations: Computational modeling of MmpL6 interactions, similar to the approach used to study MmpL5-MmpS5 interactions in siderophore export .

Functional Assays

  • Redox Sensing Systems: Using redox-sensitive GFP to monitor how MmpL6 interactions affect cellular redox state.

  • Stress Resistance Assays: Testing how disruption of specific interactions affects survival under oxidative stress.

What are the future research directions and unanswered questions regarding MmpL6?

Several important research questions remain to be addressed:

Molecular Mechanism Questions

  • Substrate Identification: What specific molecules does MmpL6 transport? Does it export oxidizing agents, import protective compounds, or transport signaling molecules that trigger protective responses?

  • Structural Determinants: What structural features of MmpL6 are essential for its function in oxidative stress response, and how do they differ from other MmpL proteins?

  • MmpS6-MmpL6 Interaction: What is the precise nature of the interaction between MmpS6 and MmpL6, and how does this interaction contribute to oxidative stress response?

Evolutionary Questions

  • Selective Pressure: What selective pressures led to the loss of the complete M6 operon in modern lineages despite its apparent advantage in stress resistance?

  • Compensatory Mechanisms: What alternative stress response mechanisms have evolved in modern lineages lacking the complete M6 operon?

  • Host Adaptation: Does the differential M6 functionality contribute to host-specific adaptation of different M. tuberculosis lineages?

Therapeutic Potential

  • Drug Target Assessment: Could MmpL6 serve as a target for novel anti-TB therapeutics, particularly for ancient lineage infections?

  • Drug Resistance Connection: Can the oxidative stress resistance provided by MmpL6 be overcome to enhance the efficacy of existing anti-TB drugs?

  • Diagnostic Applications: Could M6 operon polymorphisms serve as markers for predicting drug response or virulence in clinical isolates?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.