Recombinant Putative membrane protein mmpS1 (mmpS1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
mmpS1; BQ2027_MB0410C; Probable transport accessory protein MmpS1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
mmpS1
Target Protein Sequence
MFGVAKRFWIPMVIVIVVAVAAVTVSRLHSVFGSHQHAPDTGNLDPIIAFYPKHVLYEVF GPPGTVASINYLDADAQPHEVVNAAVPWSFTIVTTLTAVVANVVARGDGASLGCRITVNE VIREERIVNAYHAHTSCLVKSA
Uniprot No.

Target Background

Protein Families
MmpS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of MmpS1 and how does it influence experimental approaches?

MmpS1 is a putative membrane protein with a full length of 142 amino acids, primarily found in Mycobacterium species including Mycobacterium bovis . The relatively small size of MmpS1 compared to other membrane proteins makes it an attractive target for structural studies. When designing experiments with this protein, researchers should consider:

  • The presence of hydrophobic transmembrane domains, which necessitates specialized solubilization methods

  • The amphipathic character of certain domains that may impact protein-lipid interactions

  • Potential post-translational modifications that could affect protein folding and function

Unlike larger membrane proteins, MmpS1's compact structure may facilitate more efficient recombinant expression and purification, though it still presents typical membrane protein challenges regarding proper folding and stability.

Which expression systems are most effective for producing functional recombinant MmpS1?

Based on current methodologies in membrane protein research, E. coli remains the predominant expression system for MmpS1, as evidenced by commercially available products . For optimal expression:

Expression SystemAdvantagesLimitationsRecommended Tags
E. coli (BL21)Cost-effective, high yieldLimited post-translational modificationsHis-tag (N or C terminal)
P. pastorisEnhanced folding, glycosylation capabilitiesLonger production timesHis-tag, FLAG
Mammalian cellsNative-like folding environmentHigher cost, lower yieldHis-tag, Fc fusion

When expressing recombinant MmpS1, experimental design should incorporate multivariant analysis rather than the traditional univariant approach, as this allows for estimation of statistically significant variables while accounting for interactions between them. This methodology enables thorough analysis, error characterization, and efficient optimization of expression conditions .

How can researchers optimize solubilization and purification protocols for MmpS1?

Successful solubilization and purification of MmpS1 requires careful consideration of membrane protein biochemistry. The following methodological approach is recommended:

  • Membrane fraction isolation: Use differential centrifugation to separate membrane fractions containing MmpS1

  • Solubilization optimization: Test a panel of detergents (DDM, LMNG, CHAPS) at varying concentrations

  • Affinity chromatography: Leverage His-tag for IMAC purification with imidazole gradient elution

  • Quality control: Verify protein orientation and integrity using proteinase K sensitivity assays similar to those used for other membrane proteins

For orientation determination, analyzing N- and C-terminal epitope tag sensitivity to proteinase K can confirm proper membrane insertion. Comparable to techniques used for other membrane proteins, proteins with extracellular N-terminal domains will show PK sensitivity for N-terminal tags while protecting C-terminal tags in reconstituted proteoliposomes .

What techniques are most reliable for characterizing MmpS1 protein-protein interactions?

Identifying and characterizing MmpS1 interaction partners requires multiple complementary approaches:

TechniqueApplicationAdvantagesConsiderations
Pull-down assaysInitial interaction screeningRelatively simple, good specificityMay miss transient interactions
SILAC immunoprecipitationQuantitative interactome analysisHigh sensitivity, quantitative dataRequires MS expertise
BlastKOALA/KEGG analysisFunctional annotation of interaction networksPathway integration, functional contextDependent on database completeness

For comprehensive interaction characterization, the methodology employed for other membrane proteins can be adapted, using epitope-tagged constructs for reciprocal co-immunoprecipitation experiments. This approach successfully identified a complex of four interacting proteins with the AAA-ATPase Msp1 , and similar techniques can be applied to identify MmpS1 interaction partners and complexes.

How do researchers differentiate between specific and non-specific interactions when studying MmpS1?

Distinguishing genuine interactions from experimental artifacts requires rigorous controls and validation:

  • Employ multiple negative controls including:

    • Abundant membrane proteins from the same compartment (e.g., VDAC for mitochondrial studies)

    • Structurally similar but functionally distinct membrane proteins

    • Empty vector/tag-only expression constructs

  • Validate interactions through:

    • Reciprocal co-immunoprecipitation with differently tagged constructs

    • Proximity ligation assays in intact cells

    • Functional assays demonstrating biological relevance

For example, when studying Msp1 complexes, researchers confirmed specific interactions by showing that Msp1 and its interactors did not co-precipitate with VDAC or other abundant membrane proteins, establishing interaction specificity . Similar stringent controls should be implemented when investigating MmpS1 interactions.

What is the current understanding of MmpS1's role in Mycobacterium physiology and pathogenesis?

While specific functions of MmpS1 remain under investigation, research into Mycobacterium proteins provides contextual insights:

  • Potential roles in membrane organization and compartmentalization

  • Possible involvement in transport of lipids or other hydrophobic molecules

  • Contribution to cell envelope integrity, which is critical for Mycobacterium virulence

To investigate these functions, researchers can apply approaches similar to those used for other bacterial membrane proteins, including:

  • Gene knockout studies followed by phenotypic characterization

  • Expression level analysis during different growth phases or stress conditions

  • Recombination detection and horizontal gene transfer analysis

How should researchers design experiments to assess MmpS1 membrane topology?

Determining membrane topology is essential for understanding MmpS1 function. A comprehensive experimental design includes:

  • Bioinformatic prediction using multiple algorithms (TMHMM, Phobius, TOPCONS)

  • Biochemical validation through:

    • Proteinase K accessibility of strategically placed epitope tags

    • Cysteine scanning mutagenesis combined with membrane-impermeable labeling reagents

    • Glycosylation mapping using artificial glycosylation sites

Experimental validation is crucial, as proteinase K sensitivity assays with N- and C-terminal tags can distinguish cytosolic versus lumenal domains. This approach has been effectively used for other membrane proteins, where researchers determined that "the N-terminal 6xHis tag of the TA protein was sensitive to PK digestion in proteoliposomes, while its C-terminal (lumenal) opsin tag was protected" .

What are the optimal approaches for reconstituting MmpS1 into artificial membrane systems?

Functional reconstitution requires careful consideration of lipid composition and methodology:

Reconstitution MethodAdvantagesLimitationsBest Applications
Detergent dialysisGentle, high incorporation efficiencyTime-consumingFunctional studies
Direct detergent removal (Bio-Beads)Rapid, scalableLess control over vesicle sizeBinding assays
Fusion with preformed liposomesMaintains protein orientationVariable incorporationTransport studies

For functional validation, researchers should:

  • Verify proper protein orientation using protease protection assays

  • Assess protein:lipid ratios through analytical techniques

  • Confirm protein activity in the reconstituted system

Researchers can adapt methods used for other membrane proteins, where "proteoliposomes containing TA proteins and Msp1 in the correct orientation" were generated by carefully controlling reconstitution conditions and verifying orientation through protease accessibility of epitope tags .

How can researchers determine if MmpS1 forms oligomeric structures in membranes?

Understanding oligomerization states is crucial for mechanistic studies. A comprehensive approach includes:

  • Biochemical analysis:

    • Blue native PAGE of detergent-solubilized protein

    • Chemical crosslinking with membrane-permeable reagents

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

  • Biophysical techniques:

    • Single-molecule fluorescence

    • Förster resonance energy transfer (FRET)

    • Analytical ultracentrifugation of detergent-protein complexes

  • Structural biology:

    • Negative-stain electron microscopy

    • Cryo-EM for larger complexes

    • X-ray crystallography of stabilized oligomers

What are the primary challenges in expressing and purifying recombinant MmpS1, and how can they be addressed?

Membrane protein expression presents specific challenges requiring methodical troubleshooting:

ChallengePotential SolutionsValidation Methods
Low expression yieldTest different promoters, host strains, and induction conditionsWestern blot quantification
Inclusion body formationLower induction temperature, use solubility tags, optimize media compositionMembrane fraction analysis
Protein misfoldingEmploy specialized E. coli strains (C41/C43), use fusion partnersCircular dichroism, functional assays

Expression optimization should employ multivariant analysis rather than the traditional univariant approach, as this methodology "permits a thoroughly analysis compared to the traditional univariant method, where the response is evaluated changing one variable at a time while fixing the others" . This allows for more efficient identification of optimal conditions through factorial design experiments.

How can researchers verify that recombinant MmpS1 retains native structure and functionality?

Quality control is essential for meaningful biological studies:

  • Structural integrity assessment:

    • Circular dichroism to confirm secondary structure content

    • Thermal stability assays (differential scanning fluorimetry)

    • Limited proteolysis to identify stable domains

  • Functional validation:

    • Ligand binding assays if ligands are known

    • Interaction with validated protein partners

    • Complementation of knockout phenotypes

  • Membrane incorporation:

    • Proper orientation in reconstituted systems

    • Resistance to alkaline extraction (carbonate wash)

    • Detergent phase partitioning

Alkaline carbonate extraction is particularly useful, as "TbMsp1 and its interactors were predominantly recovered in the pellet when subjected to alkaline carbonate extraction at high pH, indicating that, in line with their predicted TMDs, they are all integral membrane proteins" . Similar approaches can verify MmpS1's membrane integration.

What strategies help overcome protein instability during purification and storage of MmpS1?

Maintaining protein stability throughout purification and storage requires careful optimization:

  • Buffer optimization:

    • Screen various pH conditions (typically pH 7.0-8.0)

    • Test stabilizing additives (glycerol, specific lipids, cholesterol)

    • Evaluate different salt concentrations for optimal stability

  • Detergent considerations:

    • Use mild detergents (DDM, LMNG) at concentrations minimally above CMC

    • Consider detergent exchange during purification

    • Test detergent mixtures for improved stability

  • Storage conditions:

    • Flash freezing in small aliquots

    • Addition of cryoprotectants

    • Storage at -80°C versus 4°C in concentrated form

How can structural information about MmpS1 inform drug discovery efforts for mycobacterial infections?

Structural characterization of MmpS1 has significant implications for therapeutic development:

  • Structure-based approaches:

    • Identification of potential binding pockets through computational analysis

    • Fragment-based screening against purified protein

    • Structure-activity relationship development for hit compounds

  • Drug design considerations:

    • Target specificity relative to human homologs

    • Membrane permeability of candidate compounds

    • Resistance development potential

The development of inhibitors targeting other essential proteins, such as Mps1 inhibitors for cancer treatment, provides a methodological framework. For instance, researchers have developed "a series of Mps1 inhibitors with 7H-pyrrolo[2,3-d]pyrimidine structure using scaffold hopping strategy" through careful structure-activity relationship analysis . Similar approaches could be applied to develop MmpS1-targeted compounds.

What emerging technologies are most promising for studying dynamic interactions of MmpS1 in native-like environments?

Cutting-edge technologies offer new insights into membrane protein function:

TechnologyApplication to MmpS1 ResearchKey Advantages
Native mass spectrometryIntact complex analysisPreserves non-covalent interactions
Cryo-electron tomographyVisualization in cellular contextReveals native membrane environment
Single-molecule trackingDynamic behavior in membranesCaptures transient states
Hydrogen-deuterium exchange MSConformational dynamicsMaps protein-protein interfaces

These approaches move beyond static structural models to capture the dynamic behavior of membrane proteins in their native environment, providing insights into how MmpS1 functions within the complex mycobacterial membrane system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.