Recombinant Putative membrane protein mmpS2 (mmpS2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mmpS2; BQ2027_MB0518; Probable transport accessory protein MmpS2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
mmpS2
Target Protein Sequence
MISVSGAVKRMWLLLAIVVVAVVGGLGIYRLHSIFGVHEQPTVMVKPDFDVPLFNPKRVT YEVFGPAKTAKIAYLDPDARVHRLDSVSLPWSVTVETTLPAVSVNLMAQSNADVISCRII VNGAVKDERSETSPRALTSCQVSSG
Uniprot No.

Target Background

Protein Families
MmpS family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the basic structure and properties of putative membrane protein mmpS2?

Putative membrane protein mmpS2 is a full-length protein consisting of 145 amino acids. According to available recombinant protein databases, it can be produced as a His-tagged protein in E. coli expression systems . The protein is typically available in a lyophilized form from sterile PBS at pH 7.4, often with protectants such as trehalose, mannitol, and Tween80 to maintain stability .
To properly characterize this protein, researchers should:

  • Confirm molecular weight (~65.8 kDa for the recombinant His-tagged version)

  • Verify purity (>95% by SDS-PAGE analysis)

  • Validate proper folding through circular dichroism or other structural analyses

  • Assess stability under various storage and experimental conditions

How does mmpS2 differ from MMP-2 and other matrix metalloproteinases?

Despite the similar nomenclature, putative membrane protein mmpS2 should not be confused with MMP-2 (Matrix Metalloproteinase-2), which represents a different protein family. The key differences include:

  • MMP-2 is a well-characterized metalloproteinase involved in extracellular matrix regulation and degradation

  • MMP-2 has established roles in pathways related to heart failure, atrial fibrillation, and vascular remodeling

  • MMP-2 has been extensively studied in connection with cardiovascular disease, showing associations with increased risk of incident heart failure and atrial fibrillation

  • mmpS2 is classified as a membrane protein with putative (predicted but not fully confirmed) functions
    Researchers must carefully distinguish between these proteins in their experimental design and literature reviews to avoid misattribution of functions and pathways.

What experimental design considerations are critical when studying mmpS2 function?

When designing experiments to investigate mmpS2 function, researchers should implement rigorous true experimental designs that include:

  • Clear definition of variables:

    • Independent variables: mmpS2 expression levels, experimental conditions, treatment groups

    • Dependent variables: cellular responses, molecular interactions, phenotypic changes

  • Proper controls:

    • Negative controls (e.g., empty vector transfections)

    • Positive controls (proteins with known functions similar to predicted mmpS2 functions)

    • Technical and biological replicates to ensure reproducibility

  • Randomization and blinding:

    • Random assignment of experimental units to control for extraneous variables

    • Blinded analysis to prevent observer bias

  • Appropriate statistical analysis:

    • A priori power calculations to determine sample size

    • Selection of appropriate statistical tests based on data distribution and experimental design
      For membrane proteins like mmpS2, additional considerations include membrane isolation techniques, detergent selection for solubilization, and maintenance of native conformation throughout experimental procedures.

What expression systems are optimal for recombinant mmpS2 production?

Expression SystemAdvantagesDisadvantagesBest For
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modifications, potential improper folding of membrane proteinsStructural studies, antibody production
HEK293Mammalian post-translational modifications, proper foldingLower yield, higher costFunctional studies, interaction analyses
Baculovirus/Insect cellsHigh yield, eukaryotic processingModerate cost, longer production timeLarge-scale production with PTMs
Cell-free systemsAvoids toxicity issues, direct incorporation of modified amino acidsLower yield, higher costDifficult-to-express toxic proteins
For membrane proteins like mmpS2, mammalian or insect cell systems often provide better folding and post-translational modifications that may be critical for function.

What methodologies should be employed to identify pathways involving mmpS2?

To systematically investigate the pathways involving mmpS2, researchers should implement a multi-faceted approach:

  • Transcriptomic analysis:

    • RNA-Seq following mmpS2 overexpression or knockdown

    • Analysis of co-expressed genes across tissues and conditions

  • Proteomic approaches:

    • Proximity labeling (BioID, APEX) to identify proteins in close proximity to mmpS2

    • Co-immunoprecipitation followed by mass spectrometry

    • Protein microarray analysis with purified mmpS2

  • Bioinformatic prediction:

    • Structural homology modeling to predict functional domains

    • Sequence-based function prediction algorithms

    • Network analysis using existing protein-protein interaction databases

  • Phenotypic assays:

    • Cell-based functional assays based on predicted membrane protein functions

    • Knockout/knockdown studies followed by pathway-specific assays
      The putative nature of mmpS2 requires rigorous validation of any predicted pathways through multiple complementary techniques.

How can researchers differentiate between direct and indirect interactions of mmpS2?

Distinguishing direct from indirect protein interactions is crucial for accurate pathway mapping. Researchers should:

  • Employ direct binding assays:

    • Surface plasmon resonance (SPR) with purified recombinant proteins

    • Microscale thermophoresis (MST) to measure binding affinities

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Validate in cellular contexts:

    • Förster resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Protein-fragment complementation assays (PCA)

  • Map interaction domains:

    • Deletion mutagenesis to identify critical binding regions

    • Peptide arrays to map specific interaction motifs

    • Cross-linking mass spectrometry (XL-MS) to identify interaction interfaces

  • Control experiments:

    • Competition assays with predicted binding partners

    • Use of interaction-deficient mutants as negative controls

What cutting-edge approaches can resolve the structure of mmpS2?

Determining the structure of membrane proteins like mmpS2 presents unique challenges that require specialized techniques:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for purified protein in detergent micelles or nanodiscs

    • Tomography for membrane-embedded proteins

    • Advantages include no need for crystallization and visualization of flexible regions

  • X-ray crystallography:

    • Lipidic cubic phase (LCP) crystallization specifically designed for membrane proteins

    • Use of antibody fragments or nanobodies to stabilize flexible regions

    • High-resolution structural determination when crystals can be obtained

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Solution NMR for smaller domains or fragments

    • Solid-state NMR for membrane-embedded proteins

    • Provides dynamic information about protein conformations

  • Integrative structural biology:

    • Combining multiple techniques (SAXS, HDX-MS, crosslinking-MS) with computational modeling

    • Molecular dynamics simulations to predict conformational changes
      Each approach has distinct advantages depending on the specific structural questions being addressed about mmpS2.

How can CRISPR-Cas9 genome editing be applied to study mmpS2 function?

CRISPR-Cas9 technology offers powerful approaches for functional characterization of mmpS2:

  • Loss-of-function studies:

    • Complete knockout of mmpS2 gene

    • Domain-specific mutations to disrupt particular functions

    • Conditional knockout systems (e.g., Cre-lox) for temporal control

  • Gain-of-function approaches:

    • Knock-in of fluorescent tags for live-cell imaging

    • Insertion of affinity tags for purification of endogenous complexes

    • CRISPRa (activation) for upregulation of endogenous mmpS2

  • High-throughput screening:

    • CRISPR screens to identify genetic interactions

    • Synthetic lethality screens to identify potential functional redundancy

    • Pathway-specific reporter screens to pinpoint biological processes

  • Disease modeling:

    • Introduction of patient-specific mutations

    • Isogenic cell line pairs differing only in mmpS2 status
      When designing CRISPR experiments for membrane proteins, researchers should carefully consider guide RNA design to ensure specificity and efficient editing.

How does research methodology for mmpS2 compare with approaches used for MMP-2?

While matrix metalloproteinases like MMP-2 and membrane proteins like mmpS2 require different experimental approaches, some methodological insights can be transferred:

AspectMMP-2 MethodologymmpS2 Adaptation
Activity AssaysZymography, fluorogenic substratesMembrane transport assays, interaction assays
Inhibition StudiesSmall molecule inhibitors targeting catalytic domainAntibodies or peptides targeting extracellular domains
LocalizationSecreted vs. cell-associated fractionationMembrane fractionation, surface biotinylation
Expression AnalysisELISA, Western blotWestern blot with membrane fraction enrichment
In vivo ModelsKnockout mice with vascular/cardiac phenotypesKnockout models focused on membrane-related processes
MMP-2 has been extensively studied in cardiovascular disease, with research showing its association with incident heart failure, atrial fibrillation, and structural cardiac changes . These methodologies can provide a framework for investigating potential roles of mmpS2, with appropriate modifications for membrane protein characteristics.

What can researchers learn from the bibliometric trends in MMP research when planning mmpS2 studies?

Bibliometric analysis of MMP research, particularly in conditions like ischemic stroke, reveals important trends that can inform mmpS2 research strategy:

  • Publication patterns:

    • MMP research showed rapid growth from 1998-2012, followed by stabilization and decline by 2022

    • This suggests a maturation of the field and potential research fatigue

  • Research focus evolution:

    • Initial focus on basic characterization

    • Shift toward disease associations

    • Later emphasis on therapeutic targeting

  • Methodological trends:

    • Movement from observational to mechanistic studies

    • Integration of multi-omics approaches

    • Development of increasingly specific inhibitors
      For emerging research on proteins like mmpS2, researchers should:

  • Establish solid foundational characterization before disease association studies

  • Implement cutting-edge methodologies early in the research program

  • Form collaborative networks to accelerate knowledge accumulation

  • Focus on unique aspects of mmpS2 that differentiate it from better-studied proteins

What are the optimal approaches for detecting and quantifying mmpS2 in biological samples?

For reliable detection and quantification of putative membrane proteins like mmpS2:

  • Antibody-based methods:

    • Western blotting with membrane fraction enrichment

    • Immunohistochemistry with appropriate membrane permeabilization

    • Flow cytometry for cell surface expression

    • ELISA development with capture/detection antibody pairs

  • Mass spectrometry-based approaches:

    • Targeted MS methods like multiple reaction monitoring (MRM)

    • Data-independent acquisition (DIA) for broader proteome coverage

    • Absolute quantification using isotope-labeled standards (AQUA peptides)

  • mRNA expression analysis:

    • RT-qPCR with validated reference genes

    • RNA-Seq for expression in context of whole transcriptome

    • In situ hybridization for spatial localization

  • Considerations specific to membrane proteins:

    • Detergent selection critically affects extraction efficiency

    • Native conformation preservation may be essential for antibody recognition

    • Cell surface biotinylation can distinguish surface from internal pools
      Researchers should validate detection methods using recombinant mmpS2 standards and samples with confirmed overexpression or knockdown.

How should researchers address post-translational modifications when studying mmpS2?

As a membrane protein, mmpS2 likely undergoes post-translational modifications that could significantly impact its function:

  • Identification strategies:

    • Enrichment techniques specific to modification types (e.g., phosphopeptide enrichment)

    • Mass spectrometry with electron transfer dissociation (ETD) for intact modification analysis

    • Site-specific antibodies for common modifications

  • Functional assessment:

    • Site-directed mutagenesis of modified residues

    • Pharmacological inhibition of modifying enzymes

    • Correlation of modification status with functional readouts

  • Dynamics analysis:

    • Pulse-chase experiments to determine modification kinetics

    • Stimulus-dependent changes in modification patterns

    • Subcellular localization changes associated with modifications

  • Common membrane protein modifications to consider:

    • Phosphorylation (especially for cytoplasmic domains)

    • Glycosylation (for extracellular domains)

    • Palmitoylation/myristoylation (affecting membrane association)

    • Ubiquitination (regulating turnover and trafficking)

How can researchers ensure reproducibility in mmpS2 studies?

Given the challenges in membrane protein research, ensuring reproducibility requires:

  • Standardized protocols:

    • Detailed reporting of buffer compositions, especially detergents and stabilizing agents

    • Consistent protein handling procedures to maintain native conformation

    • Validated cell lines with characterized endogenous mmpS2 expression

  • Quality control measures:

    • Batch-to-batch validation of recombinant proteins (>95% purity by SDS-PAGE)

    • Functional validation of expression constructs

    • Antibody validation using knockout controls

  • Appropriate controls:

    • Positive and negative controls for functional assays

    • Vehicle controls for all treatments

    • Isotype controls for antibody-based methods

  • Transparent reporting:

    • Complete methods documentation including unsuccessful approaches

    • Raw data sharing through appropriate repositories

    • Detailed statistical analysis plans registered before data collection

How should researchers address contradictory findings in mmpS2 research?

When facing contradictory results regarding mmpS2 function or interactions:

  • Methodological reconciliation:

    • Compare experimental conditions, cell types, and detection methods

    • Assess protein conformation preservation across studies

    • Consider expression levels and potential artifacts of overexpression

  • Biological context considerations:

    • Cell type-specific functions or interactions

    • Condition-dependent effects (stress, differentiation state)

    • Redundancy or compensation by related proteins

  • Validation strategies:

    • Independent methodologies to confirm findings

    • Rescue experiments to verify specificity

    • Dose-response relationships to assess biological relevance

  • Collaborative approaches:

    • Direct laboratory exchanges to reproduce findings

    • Multi-center validation studies

    • Preregistered replication studies for key findings

What potential roles might mmpS2 play in disease processes?

While specific disease associations for mmpS2 are not directly mentioned in the search results, membrane proteins can be involved in numerous pathological processes:

  • Potential roles to investigate:

    • Transport or channel function dysregulation

    • Altered cell signaling through membrane-associated complexes

    • Modified cell adhesion or migration properties

    • Changes in membrane compartmentalization or lipid raft association

  • Study approaches:

    • Expression analysis across disease states

    • Genetic association studies for mmpS2 variants

    • Functional impact of disease-associated mutations

    • Animal models with mmpS2 manipulation in disease contexts

  • Comparative analysis:

    • By comparison, MMP-2 has established roles in heart failure and atrial fibrillation, with higher levels associating with increased risk

    • MMP-2 is also linked to cardiac structural changes including larger left ventricular volumes, greater left ventricular mass, and poorer left atrial function

How can researchers develop targeted approaches to modulate mmpS2 function?

For developing interventions targeting mmpS2:

  • Target identification:

    • Structure-based design targeting specific domains

    • Screening for antibodies that modulate function

    • Identification of critical protein-protein interaction interfaces

  • Delivery strategies for membrane protein targeting:

    • Lipid nanoparticle formulations for membrane fusion

    • Cell-penetrating peptides for intracellular domains

    • Extracellular domain targeting with conventional biologics

  • Validation approaches:

    • Target engagement assays in relevant cell types

    • Phenotypic rescue in knockout models

    • Specificity testing against related proteins

  • Translation considerations:

    • Development of biomarkers for patient stratification

    • Predictive models for responder identification

    • Companion diagnostics for clinical application

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.