Recombinant Putative membrane protein mmpS3 (mmpS3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-299
Protein Length
full length protein
Target Names
mmpS3
Target Protein Sequence
MSGPNPPGREPDEPESEPVSDTGDERASGNHLPPVAGGGDKLPSDQTGETDAYSRAYSAP ESEHVTGGPYVPADLRLYDYDDYEESSDLDDELAAPRWPWVVGVAAIIAAVALVVSVSLL VTRPHTSKLATGDTTSSAPPVQDEITTTKPAPPPPPPAPPPTTEIPTATETQTVTVTPPP PPPPATTTAPPPATTTTAAAPPPTTTTPTGPRQVTYSVTGTKAPGDIISVTYVDAAGRRR TQHNVYIPWSMTVTPISQSDVGSVEASSLFRVSKLNCSITTSDGTVLSSNSNDGPQTSC
Uniprot No.

Q&A

What is the putative membrane protein MmpS3 and how does it relate to the MmpL family?

MmpS3 is a putative membrane protein from the Mycobacterium family, particularly identified in Mycobacterium bovis. While specific information on MmpS3 is limited, research suggests it may be functionally associated with MmpL (Mycobacterial Membrane Protein Large) transporters, particularly MmpL3. These membrane proteins are critical components in mycobacterial cell wall synthesis and lipid transport .

The relationship between MmpS3 and MmpL proteins appears to be in their complementary roles in membrane-associated processes. MmpL3 is well-characterized as an essential flippase responsible for transporting trehalose monomycolate (TMM) across the cell membrane for mycolic acid incorporation into the cell wall . MmpS3 may function as an accessory protein in these transport mechanisms, though direct experimental confirmation is needed.

How should I design experiments to investigate potential interactions between MmpS3 and MmpL3?

When investigating protein-protein interactions between MmpS3 and MmpL3, apply the three fundamental principles of experimental design (randomization, replication, and reducing noise) through the following methodological approaches:

  • Co-immunoprecipitation (Co-IP): Express tagged versions of both MmpS3 and MmpL3 (e.g., MmpS3-FLAG and MmpL3-GFP) in mycobacteria. Precipitate one protein using antibodies against its tag and probe for the presence of the other protein in the precipitate. This approach was successful in confirming the interaction between MmpL3 and PgfA .

  • Two-hybrid screening: Implement bacterial or yeast two-hybrid systems to detect direct protein-protein interactions. This method previously identified interactions between MmpL3 and several factors involved in cell wall synthesis .

  • Fluorescence co-localization: Create fluorescent protein fusions (e.g., MmpS3-mRFP and MmpL3-GFP) and analyze their spatial and temporal localization patterns using fluorescence microscopy. Similar approaches revealed that MmpL3 and PgfA display identical localization patterns, suggesting they form a complex .

  • CRISPR interference: Design CRISPRi guides targeting either mmpS3 or mmpL3 to deplete each protein independently and observe whether similar phenotypes emerge, which would suggest functional association .

  • Surface plasmon resonance (SPR): Use purified recombinant proteins to quantitatively measure binding affinities and kinetics between MmpS3 and MmpL3 .

What controls should be included when studying MmpS3 function through gene depletion?

When designing gene depletion experiments for MmpS3, include these critical controls:

  • Complementation control: Since mmpS3 may be part of an operon, integrate another copy of any downstream genes expressed by their native promoters to prevent polar effects, similar to the approach used with MSMEG_0315 in MmpL3/PgfA studies .

  • Morphological controls: Monitor cell morphology changes using phase contrast microscopy and compare with known phenotypes of related protein depletions .

  • Growth rate controls: Measure growth curves in both standard and stress conditions, comparing depletion strains with wild-type and complemented strains.

  • Protein expression verification: Use Western blot analysis to confirm successful protein depletion and expression of complementation constructs .

  • Alternative protein depletion: If using CRISPRi, create strains with inducible antisense RNA as an alternative depletion method to confirm phenotypes are not due to off-target effects.

How can I determine the three-dimensional structure of MmpS3 and identify key functional domains?

To elucidate MmpS3's structure and functional domains, employ a multi-faceted approach:

  • Cryo-electron microscopy (cryo-EM): This technique has been successful for related proteins like MmpL3, achieving resolutions as high as 2.40 Å . For membrane proteins like MmpS3, reconstitution in nanodiscs or detergent micelles (like GDN) may be necessary for structural stability.

  • X-ray crystallography: If crystallizable fragments of MmpS3 can be identified, this approach could provide high-resolution structural data. For MmpL3, crystallization succeeded after removing unstable C-terminal regions .

  • Domain mapping through limited proteolysis: Identify stable domains by subjecting the protein to controlled proteolytic digestion followed by mass spectrometry. This approach helped identify stable fragments of MmpL3 (residues 1-806, 1-776, and 1-763) .

  • Computational structure prediction: Utilize AlphaFold2 or RoseTTAFold to predict MmpS3 structure and compare with experimentally determined structures of related proteins.

  • Cavity analysis: For membrane transporters, identifying and measuring internal cavities is critical. Tools like CASTp 3.0 can calculate cavity volumes, as demonstrated for MmpL3 where periplasmic central cavity volumes ranged from 946 ų to 2,212 ų depending on conformation .

How should I analyze conformational changes in MmpS3 under different conditions?

To analyze conformational changes in MmpS3:

  • Comparative structural analysis: Calculate root mean square deviation (RMSD) between different conformational states. For MmpL3, RMSD values between different states ranged from 1.4 Å to 2.3 Å for 710 Cα atoms .

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of the protein that undergo conformational changes under different conditions by measuring hydrogen exchange rates.

  • Single-molecule FRET: Attach fluorophores to different domains of MmpS3 and measure distance changes under various conditions.

  • Molecular dynamics simulations: Model conformational changes in response to different conditions, similar to studies performed for MmpL3 at different pH values .

  • Circular dichroism spectroscopy: Monitor secondary structure changes in response to different ligands, pH, or temperature.

What methods can be used to identify potential substrates of MmpS3?

To identify MmpS3 substrates, implement these methodologies:

  • Native mass spectrometry: This technique successfully identified the binding of trehalose monomycolate (TMM) and phosphatidylethanolamine (PE) to MmpL3 with dissociation constants (Kd) of 3.7 ± 1.3 μM and 19.5 ± 6.3 μM, respectively . Apply similar approaches to test MmpS3 binding to potential substrates.

  • Lipidomic analysis: Extract and analyze lipids bound to purified MmpS3 using mass spectrometry. For MmpL3, this approach identified bound PE, diacylglycerol (DAG), phosphatidylglycerol (PG), phosphatidylinositol (PI), and cardiolipin (CDL) .

  • Photoactivatable probes: Design substrate-mimicking probes that covalently link to interacting proteins upon photoactivation. This approach enriched MmpL3 when using a TMM-resembling probe .

  • Reconstitution assays: Reconstitute MmpS3 into proteoliposomes containing fluorescent indicators (like pyranine) to monitor transport activities in response to potential substrates .

  • Substrate competition assays: If a primary substrate is identified, use competition assays with structurally related molecules to determine binding specificity and affinity.

How can I determine if MmpS3 is involved in mycolic acid transport like MmpL3?

To investigate MmpS3's potential role in mycolic acid transport:

  • Co-localization with MmpL3: Examine whether MmpS3 localizes to the same subcellular regions as MmpL3, particularly at cell poles and septa where mycolic acid transport occurs .

  • Lipid accumulation analysis: Monitor the accumulation of mycolic acid precursors (like TMM) in MmpS3-depleted cells using thin-layer chromatography or mass spectrometry, similar to studies with MmpL3 .

  • Cell wall analysis: Analyze cell wall composition in MmpS3-depleted cells, looking for changes in mycolic acid content or organization.

  • Transport assays: Develop in vitro assays using purified MmpS3 reconstituted in liposomes to test its ability to transport or facilitate the transport of mycolic acid precursors.

  • Genetic interaction studies: Test for synthetic phenotypes when combining partial depletion of MmpS3 with mutations in known mycolic acid transport or synthesis genes.

How should I design experiments to evaluate potential inhibitors of MmpS3?

When evaluating potential MmpS3 inhibitors, implement a systematic approach:

  • Direct binding assays: Use surface plasmon resonance (SPR) to confirm direct binding of inhibitors to purified MmpS3, as was done for MmpL3 inhibitors .

  • Functional inhibition assays: If MmpS3 transport activity can be reconstituted in vitro, test how inhibitors affect this activity. For MmpL3, proton transport activity in proteoliposomes was used to evaluate inhibitor efficacy .

  • Structure-activity relationship (SAR) studies: Test series of structurally related compounds to identify essential pharmacophore features. For MmpL3, various classes of inhibitors including indole-2-carboxamides, pyrrole-2-carboxamides, and quinazolines were systematically analyzed .

  • Resistant mutant isolation: Attempt to isolate spontaneous resistant mutants against potential inhibitors and sequence them to identify binding sites, as demonstrated for MmpL3 inhibitors .

  • Specificity testing: Test inhibitors against related proteins to determine specificity. The table below shows minimum inhibitory concentrations (MIC) of selected inhibitors against MmpL3 in M. tuberculosis and related transporters in C. glutamicum:

CompoundMtb H37Rv mc² 26206 (μM)C. glutamicum ATCC 13032 (μM)C. glutamicum LY108 (CmpL4) (μM)C. glutamicum LY109 (CmpL1) (μM)
IC40.05>500>5004
IC210.07>500>50031.2
IC5225.9>500>50031.2
PC888.12>500>50065.2
SQ1091.8212562.562.5
BM21219.36303030
NITD3040.01>500>500>500
AU12351.2>500>500>500

Table: Minimum inhibitory concentrations of selected compounds against M. tuberculosis and C. glutamicum strains expressing different mycolic acid transporters .

How can I track the localization patterns of MmpS3 during mycobacterial growth and division?

To track MmpS3 localization:

  • Fluorescent protein fusions: Create C-terminal or N-terminal fusions of MmpS3 with fluorescent proteins like mRFP or msfGFP. Similar approaches with MmpL3 and PgfA revealed their predominant localization at cell poles .

  • Time-lapse microscopy: Monitor fluorescently-tagged MmpS3 throughout the cell cycle using time-lapse microscopy to track dynamic changes in localization. For MmpL3 and PgfA, such analysis revealed temporal localization patterns associated with cell growth and division .

  • Quantitative image analysis: Analyze fluorescence distributions over time using line-scan analysis along the cell length. This approach revealed that MmpL3-msfGFP and PgfA-mRFP display similar spatial and temporal localization patterns, suggesting they function in the same complex .

  • Co-localization with cell division markers: Simultaneously visualize MmpS3 with markers of cell division (like FtsZ) or cell elongation to correlate localization with specific cellular processes.

  • Immunogold electron microscopy: For higher resolution localization, use immunogold labeling of MmpS3 followed by electron microscopy to precisely determine its membrane topology and subcellular positioning.

What techniques should I use to analyze changes in MmpS3 expression under different growth conditions?

To analyze MmpS3 expression changes:

  • Quantitative PCR (qPCR): Measure mmpS3 transcript levels under various conditions compared to reference genes.

  • Western blotting: Quantify MmpS3 protein levels using specific antibodies against MmpS3 or epitope tags.

  • Transcriptional reporters: Fuse the mmpS3 promoter to a reporter gene like GFP or luciferase to monitor expression in real-time.

  • RNA-seq analysis: Perform whole-transcriptome analysis under different conditions. For MmpL3 depletion, RNA-seq revealed up-regulation of 47 genes and down-regulation of 23 genes (≥3-fold change, FDR ≤1%), particularly affecting osmoprotection, metal homeostasis, energy production, and mycolic acid biosynthesis genes .

  • Ribosome profiling: Go beyond transcriptional analysis to measure active translation of MmpS3 under different conditions.

How can I determine if MmpS3 is essential for mycobacterial viability?

To assess MmpS3 essentiality:

  • Knockout attempts: Try to create a clean deletion of mmpS3 and assess viability. Failure to obtain viable knockouts suggests essentiality.

  • Conditional expression systems: Create strains where mmpS3 is under control of an inducible promoter, then observe growth and viability when expression is turned off.

  • CRISPRi depletion: Design CRISPR interference systems targeting mmpS3 and monitor phenotypic consequences of depletion, as was done for mmpL3 and pgfA .

  • Transposon mutagenesis: Perform saturating transposon mutagenesis and use deep sequencing to identify insertion sites. Absence of insertions in mmpS3 would suggest essentiality.

  • Depletion phenotype analysis: Monitor morphological changes during MmpS3 depletion. MmpL3 depletion caused cells to become progressively shorter and wider with excretion of cell wall material from poles and septa .

What approaches can I use to study potential genetic interactions between mmpS3 and other cell wall biosynthesis genes?

To study genetic interactions:

  • Double depletion experiments: Create strains where both mmpS3 and another gene of interest can be depleted, then look for synergistic effects suggesting genetic interaction.

  • Suppressor screening: In strains with mmpS3 depletion or mutation, look for secondary mutations that suppress the phenotype.

  • Synthetic lethality screening: Test if combined partial inhibition of MmpS3 and other proteins creates synergistic growth defects.

  • Protein complex purification: Use tandem affinity purification of MmpS3 followed by mass spectrometry to identify interacting partners. For MmpL3, this approach identified interactions with proteins involved in cell wall synthesis, growth, and division .

  • Genome-wide CRISPR screening: Perform genome-wide CRISPR screens in the context of MmpS3 depletion to identify genetic interactions.

How should I properly design data tables and analyze results from MmpS3 experiments?

When designing data tables and analyzing MmpS3 experimental results:

  • Identify variables: Clearly define independent and dependent variables in your experiments. For example, in inhibitor studies, the independent variable would be inhibitor concentration and the dependent variable might be growth inhibition or protein activity513.

  • Organize data tables: Structure your tables with independent variables in columns on the left and dependent variables in columns on the right. Include appropriate units of measurement513.

  • Include controls: Always incorporate positive and negative controls, and ensure biological replicates (typically at least 3) for statistical validity .

  • Statistical analysis: Apply appropriate statistical tests based on your experimental design. For comparing multiple conditions, use ANOVA followed by post-hoc tests; for comparing two conditions, use t-tests or non-parametric alternatives when appropriate.

  • Data visualization: Create clear graphs with error bars representing standard deviation or standard error. Plot independent variables on the x-axis and dependent variables on the y-axis513.

What are the most common pitfalls in MmpS3 research and how can I avoid them?

Common pitfalls in MmpS3 research and their solutions:

  • Protein degradation: Membrane proteins like MmpS3 are prone to degradation. Solution: Use freshly prepared samples, optimize buffer conditions, and include protease inhibitors. For MmpL3, researchers observed C-terminal degradation that was addressed by creating stable truncated constructs .

  • Non-specific binding: When studying protein-protein interactions, false positives may occur. Solution: Include stringent controls and validate interactions using multiple independent techniques .

  • Off-target effects in inhibitor studies: Compounds may act on multiple targets. Solution: Always confirm direct binding and perform mechanism-of-action studies. Some MmpL3 inhibitors like SQ109 were found to have off-target effects on membrane potential .

  • Phenotypic misinterpretation: Similar phenotypes may arise from different mechanisms. Solution: Use complementation studies and test multiple phenotypic readouts. For MmpL3, researchers confirmed specificity of phenotypes by comparing with effects on other proteins like MurJ .

  • Polar effects in genetic studies: Disruption of one gene may affect downstream genes in an operon. Solution: When using CRISPRi to deplete proteins, integrate additional copies of downstream genes expressed by their native promoters .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.