Recombinant Putative membrane protein mmpS4 (ML2377)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Putative Membrane Protein MmpS4 (ML2377)

Recombinant Putative membrane protein MmpS4 (ML2377) is a protein derived from Mycobacterium leprae, a bacterium responsible for leprosy. This protein is part of a siderophore export system crucial for the virulence of mycobacteria, including Mycobacterium tuberculosis (M. tuberculosis), which causes tuberculosis. The recombinant form of MmpS4 is produced in yeast and is used for research purposes, particularly in studying the mechanisms of iron acquisition and siderophore secretion in mycobacteria.

Function and Role of MmpS4

MmpS4 plays a critical role in the export of siderophores, which are iron-chelating compounds essential for the survival of mycobacteria within their host. It interacts with transporter proteins like MmpL4 and MmpL5 to facilitate the secretion of these siderophores. This interaction is crucial for the virulence of M. tuberculosis, as mutants lacking MmpS4 and its associated transporters exhibit significantly reduced virulence in animal models .

Characteristics of Recombinant MmpS4

  • Source: The recombinant MmpS4 protein is produced in yeast .

  • Purity: The protein has a purity of more than 85% as determined by SDS-PAGE .

  • Storage: It is recommended to store the protein in a lyophilized form at -20°C or -80°C for up to 12 months. Liquid forms have a shelf life of 6 months at these temperatures .

  • Reconstitution: The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage .

Interaction with Transporter Proteins

MmpS4 binds to the periplasmic loop of MmpL4 and also interacts with MmpL5, forming part of a novel siderophore export system in mycobacteria . This interaction is essential for the efficient biosynthesis and secretion of siderophores.

Impact on Virulence

Deletion of the mmpS4 and mmpS5 genes in M. tuberculosis results in a significant reduction in bacterial virulence. The bacterial burden in mouse lungs decreases by 10,000-fold, and none of the infected mice die within 180 days, compared to wild-type M. tuberculosis .

Table 1: Characteristics of Recombinant MmpS4

CharacteristicDescription
SourceYeast
Purity>85% (SDS-PAGE)
StorageLyophilized: 12 months at -20°C/-80°C; Liquid: 6 months at -20°C/-80°C
Reconstitution0.1-1.0 mg/mL in deionized sterile water with 5-50% glycerol

Table 2: Impact of MmpS4 Deletion on Virulence

StrainVirulence in Mice
Wild-type M. tuberculosisHigh virulence
ΔmmpS4/S5 mutantSignificantly reduced virulence

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if different. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ML2377; u1740w; Probable transport accessory protein MmpS4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Mycobacterium leprae (strain TN)
Target Names
ML2377
Target Protein Sequence
MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRESYADSNLGSSK PFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPWSLLMTTTLAAVMGNLVAQGN TDSIGCRIIVDGVVKAERVSNEVNAYTYCLVKSA
Uniprot No.

Target Background

Database Links

KEGG: mle:ML2377

STRING: 272631.ML2377

Protein Families
MmpS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.