Recombinant Putative membrane protein ycf1 (ycf1)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Ycf1 is implicated in:

  • Glutathione transport: Binding sites identified in the inward-facing conformation .

  • Pathogen proliferation: Knockdown of Ycf1 in Nosema bombycis (microsporidian) reduces sporulation by 40–60% .

  • Post-translational modifications:

    • 36 phosphorylation sites and 1 O-glycosylation site predicted .

    • Phosphorylation stabilizes R region interactions with NBD1, promoting ATPase activity .

Experimental Data from N. bombycis Studies :

ParameterDetails
Expression systemE. coli BL21(DE3) with pET-28a vector
Induction0.5 mM IPTG, 20°C, 20 hours
Protein size~50 kDa (vs. predicted 37 kDa)
LocalizationInclusion bodies in E. coli
Antibody validationMonoclonal antibody confirmed specificity via Western blot

Subcellular Localization

Immunofluorescence assays in N. bombycis revealed:

Life StageYcf1 LocalizationReference Protein (Nb-actin)
SporoplasmPlasma membraneCytosolic
MerontCell periphery and division sitesWhole-cell distribution
SporoblastPlasma membraneWhole-cell distribution

Role in Pathogen Proliferation

RNA interference (RNAi) studies demonstrated:

Time Post-InfectionYcf1 Expression (vs. Control)Nbβ-tubulin Copy Number (vs. Control)
24 hours↓ 35% (P < 0.05)↓ 28% (P < 0.05)
72 hours↓ 50% (P < 0.05)↓ 45% (P < 0.01)
96 hours↓ 65% (P < 0.01)↓ 60% (P < 0.001)

Potential Applications

  • Drug target: Membrane localization and transporter activity suggest utility in antifungal therapies .

  • Biotechnological tool: Structural insights into ABCC transporters could guide engineering of synthetic transporters .

Unresolved Questions

  • Mechanism of glutathione transport specificity.

  • Functional equivalence of Ycf1 phosphorylation sites across species.

  • Direct evidence for Ycf1’s role in drug resistance.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
TIC214; ycf1; Protein TIC 214; Translocon at the inner envelope membrane of chloroplasts 214; AtTIC214
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-410
Protein Length
full length protein
Species
Mesostigma viride (Green alga)
Target Names
TIC214
Target Protein Sequence
MNYLISSLPFPNNFLNSSHSPFVFGLICGSLLGTSMNVGSFISLRRLIIQGIPAGVVSYL GSAISETFFLFLILFGYIGVIEKWFTLEPSLTFIITVFCADTIIGFLLDNRLKIVSLSQT TDLLKIFLCNAVIVFGNPGSTWGATSLITSIEGFQFRENSLFLFGVFLGIFVIGCGIGFL ILALTNLWMIQSSKTFRSLIYRSNKIISHLALCILILSTIYYHWQVYIGLSLSTSSMPMI TITKHDREPFYTDDESQMSWNRYKNKVERKNQPHPMKTLGGLPIKQFGQWFKKNVITSNP EDLDARGLPRERTKTGDYVPNYETMQAIRNKKWFSRSKNYLYIKEKIFSLLSINPMKVKF LEHSRRDMDLFYLGDKKSTRITITEMSKSDYNQMLENRKQRIQNIINRRN
Uniprot No.

Target Background

Function
This protein is involved in the import of protein precursors into chloroplasts. It may function as part of an intermediate translocation complex, acting as a protein-conducting channel within the inner chloroplast envelope.
Protein Families
TIC214 family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is Ycf1 and what are its key structural characteristics?

Ycf1p in Saccharomyces cerevisiae is a member of the yeast multidrug resistance-associated protein (MRP) subfamily of ATP-binding cassette proteins that functions as a vacuolar membrane transporter . In contrast, Ycf1 in Nosema bombycis is a plasma membrane protein containing 322 amino acids with a molecular weight of approximately 50 kDa .

For N. bombycis Ycf1, bioinformatic analysis reveals specific structural characteristics:

  • One signal peptide

  • One transmembrane domain

  • Isoelectric point (pI) of 6.49

  • Secondary structure composition: 32.3% alpha-helix, 57.14% random coils, 4.35% beta sheets, and 6.21% extended fragment

  • Contains thirty-six phosphorylation sites and one O-glycosylation site

How do experimental approaches differ when studying Ycf1 from different organisms?

The experimental approaches vary significantly based on the organism:

For yeast Ycf1p:

  • Focus on mutagenesis studies targeting specific domains (e.g., lumenal loops)

  • Assessment of proteolytic processing through Western blot analysis

  • Functional assays measuring transport of substrates like cadmium and arsenite

  • Localization studies confirming vacuolar membrane positioning

For N. bombycis Ycf1:

  • Cloning and sequencing compared to reference genomes

  • Recombinant protein expression in E. coli (typically as inclusion bodies)

  • RNA interference to assess functional importance

  • Measurement of parasite proliferation following gene silencing

  • Immunofluorescence studies to confirm membrane localization

How should I design experiments to characterize the proteolytic processing of Ycf1p?

When designing experiments to characterize proteolytic processing of Ycf1p, follow this methodological framework:

  • Define your variables clearly:

    • Independent variable: Mutations in putative processing regions

    • Dependent variable: Extent of proteolytic processing

    • Control variables: Expression levels, cellular localization

  • Construct appropriate Ycf1p variants:

    • Delete specific regions (e.g., L6 ins deletion)

    • Create chimeric proteins by transferring regions between proteins

    • Introduce point mutations at potential cleavage sites

  • Verification steps:

    • Confirm proper localization to ensure phenotypes aren't due to mislocalization

    • Use wildtype Ycf1p and processing-defective mutants as controls

    • Include PEP4-dependent processing controls

  • Assessment methods:

    • Western blot analysis to detect full-length and cleaved products

    • Functional transport assays to correlate processing with activity

    • Microscopy to confirm proper vacuolar membrane localization

What is the optimal protocol for expressing recombinant Ycf1 protein?

Based on experimental evidence with N. bombycis Ycf1, the following protocol is recommended:

  • Plasmid construction:

    • Clone the full-length Ycf1 gene into an expression vector (e.g., pET-28a)

    • Confirm correct insertion through double enzyme digestion and sequencing

  • Expression optimization:

    • Transform into E. coli BL21 Star (DE3) expression strain

    • Culture in LB medium with appropriate antibiotic (e.g., 100 mg/mL Kanamycin)

    • Grow at 37°C until OD600 reaches 0.6

    • Induce with optimal IPTG concentration (0.5 mM) at lower temperature (20°C) for extended duration (20 hours)

  • Protein extraction and verification:

    • Harvest cells and disrupt by sonication (250 W, 3 s pulses, 5 s intervals, ~10 min)

    • Separate soluble and insoluble fractions by centrifugation

    • Analyze by SDS-PAGE and Western blot using Anti-His Tag antibody

    • Note that Ycf1 often expresses as inclusion bodies, requiring solubilization strategies

How can I establish causality in experimental designs when studying Ycf1 function?

To establish causality in Ycf1 function studies, implement these methodological approaches:

  • Apply systematic variable manipulation:

    • Create specific mutations targeting functional domains

    • Use RNA interference to knock down expression

    • Generate knockout strains when possible

  • Implement appropriate controls:

    • Include wildtype strains/cells

    • Use empty vector controls

    • Include non-targeting RNA interference controls

  • Measure direct functional outcomes:

    • For yeast Ycf1p: Assess transport of known substrates (cadmium, arsenite)

    • For N. bombycis Ycf1: Measure parasite proliferation using qPCR of marker genes (e.g., Nbβ-tubulin)

  • Establish dose-response relationships:

    • Vary expression levels of Ycf1

    • Assess functional outputs at different time points

    • Quantify relationships between expression level and functional outcomes

How should contradictory findings about Ycf1 function be reconciled in research?

When facing contradictory findings about Ycf1 function:

  • Systematically examine experimental conditions:

    • Compare expression systems (native vs. heterologous)

    • Analyze cellular localization differences

    • Assess post-translational modifications across studies

  • Consider organism-specific context:

    • Yeast Ycf1p undergoes proteolytic processing that affects function

    • When expressed in non-native systems (e.g., Sf21 insect cells), Ycf1p localizes to plasma membrane rather than vacuole

    • Processing patterns may vary between systems while preserving the same cleavage site vicinity

  • Evaluate substrate-specific effects:

    • Mutations may differentially affect transport of various substrates

    • Cadmium is transported as a complex with glutathione

    • Arsenite may be cotransported with glutathione

    • Different regions of the protein may be critical for different substrates

  • Integration approach:

    • Create a comprehensive model incorporating data from multiple studies

    • Identify environmental or experimental variables that explain contradictions

    • Use statistical meta-analysis techniques when sufficient quantitative data exists

What statistical approaches are most appropriate for analyzing Ycf1 localization and function data?

For analyzing Ycf1 localization and function data:

  • Localization analysis:

    • Quantitative image analysis of fluorescence microscopy data

    • Colocalization coefficients with known compartment markers

    • Statistical comparison across multiple cells and conditions using ANOVA or non-parametric tests

  • Functional transport assays:

    • Multiple time-point measurements for kinetic analysis

    • Concentration-dependent transport fitted to appropriate models (Michaelis-Menten, Hill equation)

    • Statistical comparison of transport rates and affinities across mutants

  • Gene expression and knockdown studies:

    • qPCR data analysis using ΔΔCt method with appropriate reference genes

    • Statistical comparison using t-tests or ANOVA with appropriate post-hoc tests

    • Correlation analysis between knockdown efficiency and functional outcomes

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomization and blinding procedures where possible

    • Multiple technical and biological replicates with clear reporting of variability

How can structure-function relationships in Ycf1 be systematically investigated?

To systematically investigate structure-function relationships in Ycf1:

  • Domain-specific mutagenesis strategy:

    • Target conserved motifs across MRP family proteins

    • Create chimeric proteins exchanging domains between related transporters

    • Generate progressive truncations to identify minimal functional units

  • Correlation of structural features with specific functions:

    • L6 lumenal loop region is critical for proteolytic processing

    • Membrane-spanning regions affect substrate specificity

    • Cytosolic domains influence ATP binding and hydrolysis

  • Experimental validation approach:

    Domain ModifiedMutation TypeFunctional AssessmentExpected Outcome
    L6 ins regionDeletionProteolytic processingPrevention of cleavage
    L6 ins regionTransfer to another loopProteolytic processingNovel cleavage at recipient site
    Transmembrane domainsPoint mutationsSubstrate transportAltered substrate specificity
    ATP-binding cassetteConserved residue mutationsATP hydrolysisDiminished transport activity
  • Cross-species comparative analysis:

    • Compare Ycf1p from S. cerevisiae with Ycf1 from N. bombycis

    • Analyze functional conservation despite sequence divergence

    • Identify evolutionarily conserved structural features essential for function

What approaches can determine if Ycf1 is a viable target for therapeutic intervention?

To evaluate Ycf1 as a therapeutic target, implement this systematic approach:

  • Essential function verification:

    • Conduct gene silencing experiments via RNA interference

    • Measure proliferation inhibition following knockdown

    • Quantify dose-response relationships between silencing efficiency and growth inhibition

  • Target validation strategy:

    • Confirm membrane localization accessibility

    • Assess conservation across pathogen species but divergence from host proteins

    • Evaluate potential for selective targeting

  • Proof-of-concept studies:

    • Develop small molecule inhibitors or blocking antibodies

    • Test effects on pathogen growth in vitro

    • Evaluate safety profile in host cell models

  • Experimental findings supporting therapeutic potential:

    • N. bombycis Ycf1 knockdown significantly reduces pathogen proliferation

    • The protein is consistently expressed on the plasma membrane throughout the life cycle

    • Expression peaks during rapid proliferation phase (72h post-infection)

    • Silencing Ycf1 gene significantly decreased parasite Nbβ-tubulin copy number

What are the main challenges in purifying functional recombinant Ycf1 and how can they be overcome?

The main challenges and solutions for purifying functional recombinant Ycf1 include:

  • Inclusion body formation:

    • Challenge: Recombinant Ycf1 typically expresses as inclusion bodies in E. coli

    • Solutions:

      • Decrease induction temperature (20°C optimal for N. bombycis Ycf1)

      • Use specialized E. coli strains designed for membrane protein expression

      • Employ fusion tags that enhance solubility (MBP, SUMO, etc.)

      • Optimize IPTG concentration (0.5 mM found optimal for N. bombycis Ycf1)

  • Post-translational modifications:

    • Challenge: Eukaryotic modifications absent in bacterial systems

    • Solutions:

      • Express in eukaryotic systems (yeast, insect cells) for proper modification

      • Analyze protein size discrepancies to identify modifications (N. bombycis Ycf1 appears larger than predicted, likely due to phosphorylation/glycosylation)

  • Functional reconstitution:

    • Challenge: Maintaining proper folding and activity after purification

    • Solutions:

      • Use mild detergents compatible with membrane proteins

      • Reconstitute in liposomes or nanodiscs to provide membrane environment

      • Verify function through substrate binding or transport assays

How can researchers accurately assess Ycf1 localization and trafficking in different cellular systems?

To accurately assess Ycf1 localization and trafficking:

  • Microscopy-based approaches:

    • Fluorescent protein tagging (ensuring tags don't disrupt localization)

    • Immunofluorescence with specific antibodies

    • Co-localization with compartment-specific markers

    • Live-cell imaging to track trafficking dynamics

  • Biochemical validation methods:

    • Subcellular fractionation followed by Western blot analysis

    • Surface biotinylation to confirm plasma membrane localization

    • Protease protection assays to determine membrane topology

    • Glycosylation mapping to confirm lumenal domain orientation

  • Heterologous expression considerations:

    • Validate localization in both native and expression systems

    • Note that yeast Ycf1p localizes to vacuolar membrane in native cells but plasma membrane in insect cells

    • N. bombycis Ycf1 localizes to the plasma membrane throughout its life cycle

  • Trafficking pathway analysis:

    • Use secretory pathway inhibitors to block specific trafficking steps

    • Create trafficking signal mutants to identify sorting determinants

    • Employ temperature-sensitive trafficking mutants to capture intermediates

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.