Recombinant Putative membrane protein yozS (yozS)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Putative Membrane Protein yozS (yozS)

Recombinant Putative membrane protein yozS (yozS) is a synthetic version of a protein encoded by the yozS gene (BSU18669) in Bacillus subtilis. Classified as a putative membrane protein, it is hypothesized to participate in membrane-related functions, though its exact biological role remains uncharacterized. This recombinant protein is commercially available for research purposes, enabling studies on membrane protein structure, function, and biogenesis.

Amino Acid Sequence and Transmembrane Domains

The full-length yozS protein consists of 101 amino acids, with the sequence:
MKALIFLSSLTAIGSSILGRWLGMLDDSYAVGDAWFIGVLAGLISLLILIDSQTMTKNYIVSLSTILGILGVGFIYFPAAFINILLSITLDKQKKEDLHVR .

PropertyDetail
Uniprot IDC0H420
Expression Region1-101 (full-length)
TagDetermined during production (e.g., His-tag or others)
Predicted FunctionMembrane-associated, possibly involved in transmembrane processes

The sequence includes hydrophobic regions that may form α-helical transmembrane domains, consistent with membrane protein topology .

Recombinant Production

The protein is expressed in heterologous systems (likely E. coli or B. subtilis), purified, and supplied in a Tris-based buffer with 50% glycerol . Key production parameters include:

ParameterDetail
ConcentrationProvided at ≥1 mg/mL (exact concentration not specified)
PurityNot explicitly stated; assumes high purity for research use
Expression HostLikely E. coli (common for recombinant membrane proteins)

Hypothetical Roles in Membrane Biogenesis

While no direct functional studies on yozS exist, its classification as a membrane protein suggests potential roles in:

  1. Membrane Protein Assembly: Similar to B. subtilis SpoIIIJ and YqjG, which mediate membrane insertion of complexes like F₁F₀ ATP synthase .

  2. Transmembrane Signaling: Possibility of interacting with extracellular ligands or intracellular signaling pathways, as seen in engineered CAR T-cell receptors .

Challenges in Membrane Protein Research

Recombinant membrane proteins often face challenges such as misfolding and aggregation, particularly in E. coli . Strategies to mitigate these issues include:

  • Controlled Expression: Using strains like E. coli Lemo21(DE3) to regulate T7 RNA polymerase activity .

  • In Vitro Refolding: Techniques employed for outer membrane proteins (OMPs) like Leptospira adhesins .

Limitations and Gaps

  • Functional Data: No published studies explicitly characterizing yozS’s role in B. subtilis.

  • Host Specificity: Unclear whether yozS is functional in heterologous systems or requires native B. subtilis co-factors.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize development of the specified tag.
Synonyms
yozS; BSU18669; Putative membrane protein YozS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yozS
Target Protein Sequence
MKALIFLSSLTAIGSSILGRWLGMLDDSYAVGDAWFIGVLAGLISLLILIDSQTMTKNYI VSLSTILGILGVGFIYFPAAFINILLSITLDKQKKEDLHVR
Uniprot No.

Target Background

Database Links

KEGG: bsu:BSU18669

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant yozS protein?

E. coli expression systems have been successfully employed for the recombinant production of yozS protein. The protein can be expressed as a full-length construct (1-101 amino acids) with an N-terminal His-tag to facilitate purification . When designing expression strategies for membrane proteins like yozS, researchers should consider several factors:

  • Expression vector selection: Vectors with appropriate promoters for controlled expression help prevent toxicity issues common with membrane proteins

  • Host strain optimization: BL21(DE3) or derivatives designed for membrane protein expression may improve yields

  • Induction conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often enhance proper folding

  • Fusion tags: The N-terminal His-tag approach has proven successful for yozS and facilitates purification

While E. coli is the documented system for yozS expression, researchers investigating complex functional studies might consider alternative systems such as Bacillus species (homologous expression) or cell-free systems for difficult membrane proteins .

What purification strategies are recommended for His-tagged recombinant yozS?

Purification of His-tagged recombinant yozS protein typically follows standard immobilized metal affinity chromatography (IMAC) protocols with specific adaptations for membrane proteins. The following stepwise approach is recommended:

  • Cell lysis: Gentle disruption methods (sonication or pressure-based systems) in the presence of protease inhibitors

  • Membrane solubilization: Use of appropriate detergents (typically non-ionic or zwitterionic) to extract the membrane protein

  • IMAC purification: Using Ni-NTA or similar matrices with imidazole gradient elution

  • Polishing steps: Size exclusion chromatography to improve purity and remove aggregates

The purified protein has been reported to achieve greater than 90% purity as determined by SDS-PAGE analysis . Throughout the purification process, maintaining the native conformation of yozS is crucial, so non-denaturing conditions should be maintained wherever possible.

What are the optimal storage conditions for preserving yozS stability and activity?

Recombinant yozS protein is typically supplied as a lyophilized powder, and proper storage is essential to maintain its integrity. The following storage protocols are recommended based on available data:

  • Long-term storage: Store at -20°C/-80°C upon receipt

  • Working aliquots: Can be stored at 4°C for up to one week

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Glycerol addition: Addition of 5-50% glycerol (typically 50%) for freeze-thaw protection

Importantly, repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and aggregation . For reconstitution, it is recommended to briefly centrifuge the vial before opening and to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

How can membrane proteome analysis techniques be applied to study yozS?

Membrane proteome analysis of proteins like yozS can be approached using several complementary techniques:

  • Recombinant antibody microarrays: These provide a powerful platform for analyzing membrane proteins in crude cell lysates and tissue extracts under non-denaturing conditions . This approach allows for:

    • Detection of yozS in its native environment

    • Quantitative analysis of expression levels

    • Comparison between different cellular states or conditions

  • Non-fractionated membrane proteome analysis: Optimized protocols have been developed that enable:

    • Extraction of membrane proteins without denaturation

    • Labeling strategies compatible with membrane proteins

    • Simultaneous profiling of both membrane proteins and water-soluble proteins

When applying these techniques to yozS research, it's crucial to optimize extraction conditions to maintain the native conformation of the protein while effectively solubilizing it from the membrane environment.

What structural analysis methods are appropriate for characterizing yozS?

Understanding the structural features of putative membrane proteins like yozS requires specialized approaches due to their hydrophobic nature and membrane integration. Several complementary methods can be employed:

  • Computational prediction:

    • Transmembrane domain prediction

    • Secondary structure analysis

    • Homology modeling if suitable templates exist

  • Experimental methods:

    • Circular dichroism (CD) spectroscopy for secondary structure content

    • Limited proteolysis to identify exposed regions

    • Cysteine scanning mutagenesis to map topology

    • Detergent screening to identify optimal solubilization conditions

  • Advanced structural biology techniques:

    • NMR spectroscopy for dynamics and structure determination

    • X-ray crystallography if crystallization conditions can be established

    • Cryo-electron microscopy for structural determination in near-native environments

The selection of appropriate methods depends on research objectives, available resources, and the specific properties of yozS as determined through preliminary characterization experiments.

How can functional characterization studies of yozS be designed and implemented?

Functional characterization of putative membrane proteins like yozS presents significant challenges due to limited prior knowledge. A systematic approach includes:

  • Bioinformatic analysis:

    • Sequence-based prediction of functional domains

    • Identification of conserved motifs across homologs

    • Evolutionary analysis to identify functionally important residues

  • Gene disruption or knockdown studies:

    • Creating yozS knockout mutants in Bacillus subtilis

    • Phenotypic characterization under various growth conditions

    • Complementation studies to confirm phenotype attribution

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with native or tagged yozS

    • Bacterial two-hybrid screening for interaction partners

    • Cross-linking followed by mass spectrometry identification

  • Reconstitution experiments:

    • Incorporation into liposomes or nanodiscs

    • Transport assays if yozS is hypothesized to function as a transporter

    • Electrophysiology studies if channel activity is suspected

These approaches should be conducted in parallel, with results from each method informing the design of subsequent experiments to build a comprehensive understanding of yozS function.

What are the key considerations for comparative analysis of yozS homologs across bacterial species?

Comparative analysis of yozS homologs can provide valuable insights into evolutionary conservation, functional importance, and potential applications. Key considerations include:

  • Homolog identification strategy:

    • BLAST/PSI-BLAST searches against bacterial genomes

    • Profile Hidden Markov Models for sensitive detection

    • Criteria for inclusion (e-value thresholds, coverage requirements)

  • Sequence analysis:

    • Multiple sequence alignment methods optimized for membrane proteins

    • Conservation scoring of individual residues

    • Identification of clade-specific variations

  • Physiological context comparison:

    • Genomic neighborhood analysis

    • Co-occurrence patterns with other genes

    • Expression condition comparison across species

  • Structure-function relationship:

    • Mapping conserved residues onto structural models

    • Correlation of sequence variations with physiological differences

    • Identification of potential functional motifs

This comparative approach can reveal evolutionarily constrained regions that are likely essential for function, as well as variable regions that might confer species-specific adaptations.

How can researchers address solubility and stability issues when working with recombinant yozS?

Membrane proteins like yozS frequently present solubility and stability challenges. The following strategies can help address these issues:

  • Detergent optimization:

    • Systematic screening of detergent types (non-ionic, zwitterionic, mild ionic)

    • Detergent concentration optimization

    • Mixed detergent systems for improved stability

  • Buffer optimization:

    • pH screening (typically pH 6.5-8.5 for membrane proteins)

    • Salt concentration optimization to reduce aggregation

    • Addition of stabilizers (glycerol, trehalose, specific lipids)

  • Protein engineering approaches:

    • Truncation constructs to remove flexible regions

    • Fusion partners to enhance solubility

    • Thermostabilizing mutations based on computational prediction

  • Alternative solubilization strategies:

    • Amphipols for detergent-free handling

    • Nanodiscs for lipid bilayer environment

    • Styrene maleic acid lipid particles (SMALPs) for native membrane extraction

For yozS specifically, the documented stability in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 provides a starting point, with glycerol addition (5-50%) recommended for freeze-thaw protection .

What approaches can resolve discrepancies in experimental data regarding yozS function or interactions?

When facing contradictory or inconsistent results in yozS research, several structured approaches can help resolve discrepancies:

  • Methodology validation:

    • Control experiments to verify assay performance

    • Independent replication using alternative techniques

    • Blind analysis to minimize confirmation bias

  • Condition-dependent analysis:

    • Systematic variation of experimental conditions

    • Testing of environmental factors (pH, temperature, ionic strength)

    • Time-course studies to capture dynamic effects

  • Orthogonal approaches:

    • Combining in vitro and in vivo methods

    • Integrating biochemical, genetic, and structural approaches

    • Computational modeling to reconcile seemingly contradictory data

  • Collaborative verification:

    • Inter-laboratory validation

    • Sharing of protocols, reagents, and raw data

    • Meta-analysis of multiple independent studies

These approaches acknowledge that apparent contradictions often reflect biological complexity rather than experimental error, and may lead to new insights about context-dependent functions of yozS.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.