Recombinant Putative methyl-accepting chemotaxis AlkN (alkN)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
alkN; Putative methyl-accepting chemotaxis AlkN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-492
Protein Length
full length protein
Species
Pseudomonas oleovorans
Target Names
alkN
Target Protein Sequence
MNCSLRCRFFLILVMAGFSFFVALFGMRLMHKMAEFAYFEREHVVALSKVYYELHKKEIN ISFIVGQVQRARRQTTAVNSLWKGDKALLRLLGKGLILELSEASEIKLGLLERYASSIYK DGLNPGHIEEMKRLVSWPYTNSNRFGIEIADISKRVKAYVYFLVVSINCLFFVVIFLLMK KTRSSIDEIVHVMNDMSRGDLTYRTIPSNDEVGKMQSSIIAMGAGVSALIESIKHIQGDL FNSAGEALNISQSTSNDICDQAGKIDEFVSALSQISFAITETSNAANKSSALSSEGRQLA VHGQKAIETAVSSINALSQRVNDSHVAIKCIEADIAKIGKIIEIIDQITDQTNLLALNAA IEAAHAGEAGKGFAVVADEVRSLAQRTNNSTYEIQAMIASLNKGIFFALGVMGDCVVESK NSVNAASEASRSIEKIVDSVSQVMLQIAQVATASEEQSAVVKDMLDNANIIREIAAGVEL GSRRISEVNTHR
Uniprot No.

Target Background

Function

Chemotactic-signal transducers respond to environmental changes in attractant and repellent concentrations. They transduce external signals into intracellular signals and facilitate sensory adaptation through methylation level variations.

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Putative methyl-accepting chemotaxis AlkN (alkN)?

Recombinant Putative methyl-accepting chemotaxis AlkN (alkN) is a bacterial protein originally identified in Pseudomonas oleovorans that functions within chemotactic signaling pathways. The full-length protein consists of 492 amino acids and is often expressed with tags (such as His-tag) to facilitate purification and experimental manipulation. The protein is classified as a methyl-accepting chemotaxis protein (MCP), which typically functions as a transmembrane receptor in bacterial chemotaxis systems, detecting environmental signals and initiating appropriate cellular responses .

For research applications, the protein is available in multiple formats, including the full-length version (1-492aa) and partial constructs, expressed primarily in E. coli expression systems. The recombinant versions maintain the functional domains necessary for studying chemotactic behavior and signal transduction mechanisms .

What expression systems are used for recombinant production of AlkN?

Each expression system offers distinct advantages:

Expression SystemAdvantagesTypical YieldPost-translational Modifications
E. coliCost-effective, rapid, high yield5-50 mg/LLimited
YeastEukaryotic processing, moderate cost1-10 mg/LModerate complexity
BaculovirusInsect cell modifications, high-quality protein1-5 mg/LMore complex than yeast
Mammalian CellMost native-like modifications0.1-1 mg/LMost complex

E. coli remains the most commonly used system due to its balance of cost, yield, and the functional integrity of the expressed protein for most research applications .

How does AlkN function in bacterial chemotaxis pathways?

AlkN functions as a sensory component in bacterial chemotaxis, a process by which bacteria detect and respond to chemical gradients in their environment. As a methyl-accepting chemotaxis protein (MCP), AlkN spans the bacterial membrane and participates in a sophisticated signal transduction cascade.

The functional mechanism involves:

The name "AlkN" suggests a potential role in sensing alkanes or related hydrocarbons, which would align with Pseudomonas oleovorans' known capability to metabolize these compounds. Understanding this protein's specificity and signaling mechanism requires extensive biochemical and structural characterization .

What experimental designs are effective for studying AlkN protein-ligand interactions?

To study AlkN protein-ligand interactions, researchers should employ multiple complementary approaches to generate robust and reproducible data. Effective experimental designs include:

  • Isothermal Titration Calorimetry (ITC):

    • Directly measures thermodynamic parameters (ΔH, ΔS, KD) of binding

    • Requires 0.1-1 mg of purified protein per experiment

    • Buffer composition must be identical between protein and ligand solutions

    • Temperature control is critical for reproducible results

  • Microscale Thermophoresis (MST):

    • Measures changes in thermophoretic mobility upon ligand binding

    • Requires fluorescently labeled protein (either via His-tag or direct labeling)

    • Uses significantly less protein than ITC (μg quantities)

    • Less sensitive to buffer mismatches

  • Surface Plasmon Resonance (SPR):

    • Provides real-time association/dissociation kinetics

    • His-tagged AlkN can be immobilized on Ni-NTA sensor chips

    • Requires careful reference surface preparation

    • Flow rate optimization is essential for quality data

  • Fluorescence-based assays:

    • Intrinsic tryptophan fluorescence changes upon ligand binding

    • Extrinsic probes can be introduced at specific sites

    • Amenable to high-throughput screening of potential ligands

Upon reconstitution from lyophilized powder, the protein should be buffer-exchanged into an appropriate experimental buffer, typically containing 20-50 mM Tris or phosphate, 100-150 mM NaCl, at pH 7.4-8.0 . Glycerol (5-10%) can enhance protein stability during experiments. The presence of detergents may be necessary to maintain proper folding of transmembrane regions.

How can researchers differentiate between specific and non-specific interactions in AlkN binding studies?

Differentiating specific from non-specific interactions is crucial for accurately characterizing AlkN function. Methodological approaches include:

  • Control experiments:

    • Use structurally related but inactive compounds as negative controls

    • Include a denatured protein control to assess non-specific binding

    • Test binding with other MCPs to confirm specificity to AlkN

  • Competition assays:

    • Perform displacement studies with unlabeled putative ligands

    • Calculate IC50 values to quantify relative binding affinities

    • True ligands will show concentration-dependent competition

  • Mutagenesis studies:

    • Introduce point mutations in predicted binding sites

    • Measure how mutations affect binding parameters

    • Systematic alanine scanning can map the binding interface

  • Structural analysis:

    • Use hydrogen-deuterium exchange mass spectrometry to identify protected regions

    • Perform cross-linking studies to identify proximity relationships

    • Computational docking validated by experimental data

When analyzing binding data, researchers should employ multiple binding models (one-site, two-site, cooperative) and select the model with the best statistical fit. Scatchard or Hill plots can help visualize cooperative binding behavior that may be present in AlkN interactions with ligands .

What are the optimal storage and handling conditions for recombinant AlkN protein?

Proper storage and handling are critical for maintaining AlkN protein activity. Based on manufacturer recommendations and protein biochemistry principles:

For lyophilized protein:

  • Store at -20°C/-80°C

  • Shelf life is approximately 12 months when properly stored

  • Bring vials to room temperature before opening to prevent condensation

  • Brief centrifugation prior to opening is recommended to collect material at the bottom of the vial

For reconstituted protein:

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  • Aliquot into small volumes to minimize freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Long-term storage requires -20°C/-80°C temperatures

Handling precautions:

  • Repeated freeze-thaw cycles significantly reduce activity and should be avoided

  • When thawing, keep the protein on ice

  • Use low-protein binding tubes to prevent adsorption losses

  • Consider adding protease inhibitors for extended work sessions

The protein stability is highly dependent on buffer composition. For functional studies, Tris/PBS-based buffers at pH 8.0 containing 6% trehalose have been shown to maintain protein integrity during storage .

What purification strategies yield the highest purity and activity of recombinant AlkN?

Obtaining high-purity, active AlkN protein requires carefully designed purification protocols. The most effective purification strategy involves:

  • Initial capture:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Ni-NTA resin with imidazole gradient elution (20-250 mM)

    • Critical wash steps to remove non-specifically bound proteins

    • Addition of low concentrations of detergent (0.05% DDM or equivalent) may be necessary for membrane protein solubility

  • Intermediate purification:

    • Ion exchange chromatography (typically anion exchange at pH 8.0)

    • Salt gradient elution (typically 0-500 mM NaCl)

    • This step effectively removes most contaminants with different charge properties

  • Polishing step:

    • Size exclusion chromatography (Superdex 200 or equivalent)

    • Assesses protein homogeneity and removes aggregates

    • Provides information about oligomeric state

  • Quality control:

    • SDS-PAGE analysis (>85-90% purity is typically achievable)

    • Western blot confirmation with anti-His antibodies

    • Mass spectrometry to confirm protein identity and integrity

Throughout purification, maintaining protein stability is crucial. Buffer components that enhance stability include:

  • 10-15% glycerol

  • 1-5 mM DTT or β-mercaptoethanol

  • Protease inhibitor cocktail

  • Optimized detergent concentration if working with the full transmembrane protein

The purification process should be performed at 4°C whenever possible to minimize protein degradation. After final purification, the protein can be concentrated using centrifugal filters with appropriate molecular weight cutoffs (30-50 kDa) .

How can researchers assess the functional activity of purified AlkN protein?

Verifying the functional activity of purified AlkN is essential before proceeding with complex experiments. Several methodological approaches can be used:

  • Ligand binding assays:

    • Fluorescence anisotropy with fluorescently labeled ligands

    • Equilibrium dialysis with radiolabeled compounds

    • Bio-layer interferometry for real-time binding kinetics

    • These methods provide direct evidence of binding capability

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Thermal shift assays to determine protein stability

    • Limited proteolysis to verify correct folding

    • Native PAGE to assess oligomeric state

  • Functional reconstitution:

    • Incorporation into liposomes or nanodiscs

    • FRET-based assays to monitor conformational changes upon ligand binding

    • In vitro coupling with purified CheA/CheW to recreate signaling complex

    • Measurement of CheA autophosphorylation in response to ligands

  • Cellular assays:

    • Complementation of AlkN-deficient bacterial strains

    • Chemotaxis capillary assays with reconstituted protein

    • Swimming pattern analysis in soft agar plates

Data analysis should include appropriate controls, such as heat-denatured protein or known inactive mutants. Activity measurements should be reported with statistical analysis (typically mean ± standard deviation from at least three independent experiments) .

What are the key methodological considerations for studying AlkN in the context of complete chemotaxis signaling arrays?

Studying AlkN within complete chemotaxis signaling arrays presents unique methodological challenges that require specialized approaches:

  • Reconstitution of signaling complexes:

    • Controlled ratios of AlkN:CheA:CheW components (typically 6:2:2)

    • Assembly on lipid vesicles or supported bilayers

    • Use of membrane scaffolds to mimic native environment

    • Verification of complex formation by electron microscopy or FRET

  • Signaling activity measurements:

    • CheA autophosphorylation assays using [γ-32P]ATP

    • Phosphotransfer to response regulator CheY

    • FRET-based reporters for conformational changes

    • These assays directly measure the functional output of the complex

  • Array formation analysis:

    • Cryo-electron microscopy of reconstituted arrays

    • Fluorescence microscopy with labeled components

    • Quantification of clustering and hexagonal lattice formation

    • These methods verify proper higher-order structure formation

  • Stimulus-response coupling:

    • Real-time monitoring of activity changes upon ligand addition

    • Methylation/demethylation kinetics using radiolabeled methyl groups

    • Adaptation time course measurements

    • These experiments reveal the dynamic properties of the system

When designing these experiments, it is essential to consider the native stoichiometry of components and the physical constraints of the membrane environment. The use of detergents must be carefully optimized, as excess detergent can disrupt array formation while insufficient detergent leads to protein aggregation .

How can researchers address solubility issues when working with recombinant AlkN?

Solubility challenges are common when working with membrane proteins like AlkN. Methodological solutions include:

  • Expression optimization:

    • Lower induction temperature (16-25°C)

    • Reduced inducer concentration

    • Co-expression with chaperones

    • Use of specialized E. coli strains (C41/C43, Lemo21)

    • These modifications slow protein production and improve folding

  • Solubilization strategies:

    • Screening detergent panels (ranging from harsh to mild)

    • Optimal detergent:protein ratios

    • Addition of stabilizing lipids

    • Use of amphipols or nanodiscs for detergent-free handling

    • These approaches maintain native protein structure while improving solubility

  • Buffer optimization:

    • pH screening (typically 7.0-8.5)

    • Salt concentration adjustment (100-500 mM)

    • Addition of glycerol (10-20%)

    • Inclusion of specific stabilizing additives (arginine, trehalose)

    • These modifications can significantly enhance protein stability

  • Alternative solubilization approaches:

    • Truncation of hydrophobic regions

    • Fusion to solubility-enhancing partners (MBP, SUMO)

    • Production of isolated domains

    • These protein engineering approaches can improve expression yield and solubility

When working with the reconstituted protein, maintaining a 5-50% glycerol concentration and adding 6% trehalose to the buffer have been shown to significantly improve protein stability. For functional studies requiring membrane mimetics, screening multiple detergent types is essential to identify conditions that maintain native-like structure and activity .

What approaches can resolve inconsistent activity results in AlkN functional assays?

Inconsistent activity results are a common challenge in AlkN research. Methodological solutions include:

  • Protein quality assessment:

    • Verify purity by SDS-PAGE (>85-90% is typically required)

    • Confirm protein identity by mass spectrometry

    • Assess aggregation state by size exclusion chromatography

    • These quality controls ensure that observed activity variations aren't due to sample heterogeneity

  • Assay standardization:

    • Implement rigorous temperature control (±0.5°C)

    • Prepare fresh reagents for each experiment

    • Include internal standards and positive controls

    • Use consistent protein:lipid ratios in reconstitution

    • These practices minimize experimental variables

  • Data analysis refinement:

    • Perform statistical analysis across multiple batches

    • Normalize data to internal standards

    • Apply appropriate curve-fitting algorithms

    • Consider Bayesian approaches for complex datasets

    • These analytical methods improve data interpretation

  • Experimental design optimization:

    • Use factorial design to identify critical parameters

    • Implement response surface methodology to optimize conditions

    • Include time-course measurements to capture kinetic effects

    • These approaches systematically identify sources of variability

When analyzing inconsistent results, researchers should consider protein batch variation, buffer composition differences, and instrument calibration status. Maintaining detailed laboratory records of all experimental parameters is essential for troubleshooting inconsistencies .

What quantitative research methods are most appropriate for comparative studies of AlkN variants?

Comparative studies of AlkN variants require rigorous quantitative approaches to detect meaningful differences. The most appropriate methods include:

  • Binding kinetics analysis:

    • Surface plasmon resonance to determine kon, koff, and KD values

    • Isothermal titration calorimetry for thermodynamic parameters

    • These methods provide quantitative binding parameters for direct comparison

  • Structural dynamics assessment:

    • Hydrogen-deuterium exchange mass spectrometry

    • Site-directed spin labeling coupled with EPR

    • FRET-based conformational monitoring

    • These techniques reveal differences in protein flexibility and dynamics

  • Functional output quantification:

    • In vitro kinase activity assays measuring phosphorylation rates

    • Dose-response curves for ligand activation

    • Adaptation kinetics measurement

    • These assays quantify the functional consequences of structural changes

  • Statistical analysis framework:

    • ANOVA with post-hoc tests for multiple variant comparison

    • Principal component analysis for multidimensional data

    • Hierarchical clustering to identify functional groups

    • These statistical approaches extract meaningful patterns from complex datasets

The experimental design should include both technical and biological replicates, with appropriate controls for each variant. When comparing variants, it is essential to maintain consistent protein preparation protocols and assay conditions. Normalizing results to a reference variant (typically wild-type) facilitates direct comparison .

How can researchers integrate qualitative and quantitative methods when investigating AlkN function?

Integrating qualitative and quantitative approaches provides a more comprehensive understanding of AlkN function. Methodological strategies include:

When publishing mixed-methods research on AlkN, it is important to clearly describe both qualitative observations and quantitative measurements, including the logical connections between them. This integration is particularly valuable for complex phenomena like chemotactic signaling, where purely qualitative or quantitative approaches alone may miss important aspects of system behavior 6.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.