Recombinant Putative neuropeptide Y receptor 11 (npr-11)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Neuromodulation

NPR-11 regulates neural circuits linked to feeding behavior, sensory processing, and stress responses in C. elegans. Key functional insights include:

  • Ligand specificity: Binds neuropeptides such as FLP-21 (GLGPRPLRFamide) and FLP-34–1 (ADISTFASAINNAGRLRYamide) with nanomolar affinity .

  • C-terminal motif dependency: Receptor activation requires C-terminal residues (e.g., –RFamide or –RxRYamide motifs) for high-affinity interactions .

  • Neural feedback loops: NPR-11 in AIA interneurons interacts with NLP-1 released from AWC sensory neurons, triggering insulin-like peptide (INS-1) secretion to modulate AWC activity during food-seeking behavior .

Recombinant Production and Applications

Recombinant NPR-11 is critical for in vitro studies of peptide-receptor interactions and signaling mechanisms.

Applications:

  • Drug discovery: Screens for ligands targeting NPY-like receptors in metabolic or neurological disorders.

  • Structural studies: Cryo-EM and mutagenesis to map binding pockets (e.g., conserved ECL2 residues critical for peptide docking) .

  • Behavioral assays: Links NPR-11 activation to phenotypes like aggregation suppression and ethanol tolerance in C. elegans .

Comparative Insights from Human NPY Receptors

While NPR-11 is distinct from human Y1/Y2/Y4 receptors, structural parallels exist:

  • Binding pocket conservation: Acidic residues in extracellular loop 2 (ECL2) stabilize ligand interactions (e.g., E5.27 in NPR-1 vs. E5.23 in NPR-11) .

  • Conformational flexibility: NPY peptides adopt distinct folds when bound to different receptors, a feature mirrored in FLP-NPR-11 interactions .

Research Findings and Implications

Recent studies highlight NPR-11’s versatility:

  • Promiscuous ligand interactions: NPR-11 is activated by multiple FLP peptides (e.g., FLP-1, FLP-8, FLP-14) with EC50 values ranging 0.1 pM–22 μM .

  • Pathway modulation: Couples to Gαi/o proteins, reducing cAMP levels and influencing downstream effectors like INS-1 .

  • Disease relevance: NPR-11 orthologs in mammals are implicated in appetite regulation and pain signaling, suggesting translational potential .

Challenges and Future Directions

Current limitations include incomplete mapping of NPR-11’s in vivo interactome and species-specific signaling divergence. Future work may prioritize:

  • High-resolution structures: To elucidate dynamic peptide-binding mechanisms.

  • CRISPR-based models: For tissue-specific receptor knockout studies.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for your convenience.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Minimize repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
npr-11; C25G6.5; Putative neuropeptide Y receptor 11; NPY-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-455
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
npr-11
Target Protein Sequence
MGSVNESCDNYVEIFNKINYFFRDDQVINGTEYSPKEFGYFITFAYMLIILFGAIGNFLT IIVVILNPAMRTTRNFFILNLALSDFFVCIVTAPTTLYTVLYMFWPFSRTLCKIAGSLQG FNIFLSTFSIASIAVDRYVLIIFPTKRERQQNLSFCFFIMIWVISLILAVPLLQASDLTP VFVEPSCDLALYICHEQNEIWEKMIISKGTYTLAVLITQYAFPLFSLVFAYSRIAHRMKL RFANRNQNVTTNTNTSQRRRSVVERQRRTHLLLVCVVAVFAVAWLPLNVFHIFNTFELVN SFSVTTFSICHCLAMCSACLNPLIYAFFNHNFRIEFMHLFDRVGLRSLRVVIFGEQESLK KSMRTEFRSRGGCKTVTTAEPATFQRMNESMILSAMEQDEQLSSGGKLFVLKKYILKMFQ KGGHKQSTPASPRLGFGYNSIMTSELFSIVEGVLS
Uniprot No.

Target Background

Function
This protein is potentially a receptor for neuropeptide Y and peptide YY.
Database Links

KEGG: cel:CELE_C25G6.5

STRING: 6239.C25G6.5

UniGene: Cel.25924

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic structure of npr-11 and how is it characterized?

Neuropeptide receptors like npr-11 are typically characterized through genomic DNA sequence analysis. Researchers begin by retrieving genomic DNA sequences from databases such as GenBank, followed by designing PCR primers to amplify coding exons and flanking intronic sequences . For comprehensive characterization, both the exon-intron boundaries and the complete coding sequence must be analyzed to identify potential variants and conservation patterns across species. When approaching npr-11 characterization, researchers would follow similar methodological approaches as used for other neuropeptide receptors, including PCR amplification of target regions followed by sequencing using technologies such as capillary sequencing .

How is npr-11 expression regulated in different tissues?

The expression pattern of neuropeptide receptors varies across tissues and can be developmentally regulated. Research approaches to determine expression patterns typically include:

  • Quantitative PCR (qPCR) to measure transcript levels across tissues

  • In situ hybridization to localize expression within specific anatomical structures

  • Immunohistochemistry using specific antibodies to detect protein expression

  • Reporter gene assays using the npr-11 promoter to track expression patterns

Similar to other neuropeptide receptors, npr-11 expression is likely regulated through complex mechanisms involving transcription factors, epigenetic modifications, and possibly post-transcriptional regulation. Understanding these patterns requires systematic tissue analysis under various physiological conditions and developmental stages.

What are the key structural domains of the NPR-11 protein?

Neuropeptide receptors typically contain several functional domains that are crucial for their activity. Based on structural analyses of related receptors, NPR-11 likely contains:

  • An extracellular domain (ECD) responsible for ligand binding

  • Transmembrane domains that anchor the receptor in the cell membrane

  • Intracellular domains involved in signal transduction

Structural modeling of neuropeptide receptors often employs homology models based on crystal structures of related proteins. For instance, similar approaches to those used for NPR-B could be applied, using programs such as SWISS-MODELER and structure-validation programs like ERRAT to ensure model quality . Such models help researchers predict how specific amino acid residues contribute to receptor function and how mutations might affect receptor activity.

What expression systems are optimal for producing recombinant NPR-11?

For functional studies of neuropeptide receptors, researchers must consider several expression systems:

Expression SystemAdvantagesLimitationsTypical Yield
HEK 293 CellsMammalian post-translational modifications, high transfection efficiencyHigher cost, slower growthModerate to high
CHO CellsStable integration possible, proper foldingComplex media requirementsModerate
E. coliRapid growth, high yield, economicalLacks post-translational modificationsHigh but often inactive
Insect CellsBetter for membrane proteins than E. coliMore technical expertise requiredModerate

For functional studies of neuropeptide receptors like NPR-11, mammalian expression systems such as HEK 293 cells are often preferred, as they provide appropriate post-translational modifications and membrane localization. Similar approaches have been successfully employed for related receptors such as NPR-B, where transfection into HEK 293 cells allowed measurement of functional activity .

What methods are most effective for measuring NPR-11 activity in vitro?

Assessment of receptor activity requires specialized assays that detect signaling pathway activation:

  • cGMP or cAMP accumulation assays (depending on G-protein coupling)

  • Calcium mobilization assays using fluorescent indicators

  • Receptor internalization studies using fluorescently tagged receptors

  • Radioligand binding assays to measure ligand affinity and receptor density

For receptors that signal through cGMP, such as natriuretic peptide receptors, researchers have successfully measured activity by stimulating transfected cells with the appropriate ligand and quantifying cyclic nucleotide production . Similar approaches could be adapted for npr-11, though the specific second messenger system would need to be determined experimentally.

How can site-directed mutagenesis reveal functional domains of NPR-11?

Site-directed mutagenesis represents a powerful approach to determine structure-function relationships in receptor proteins. The methodology typically involves:

  • Identifying conserved residues through multiple sequence alignments

  • Generating mutations using techniques such as PCR-based mutagenesis

  • Expressing wild-type and mutant receptors in appropriate cell systems

  • Comparing functional parameters between wild-type and mutant receptors

For example, in studies of NPR-B, missense mutations were generated through site-directed mutagenesis in expression constructs, and their activity was measured in transfected cells . Mutations affecting highly conserved residues in the extracellular domain disrupted ligand binding, while mutations in intracellular domains affected signal transduction. A similar approach for NPR-11 would help identify critical functional residues and domains.

What are the challenges in distinguishing NPR-11 signaling from other neuropeptide receptors?

A significant challenge in neuropeptide receptor research involves distinguishing specific signaling pathways when multiple receptors are expressed in the same tissues. Advanced strategies include:

  • Using receptor-specific antagonists to block individual receptor subtypes

  • Employing CRISPR/Cas9 genome editing to create receptor-specific knockouts

  • Developing conditional expression systems to control receptor expression temporally

  • Utilizing biased ligands that selectively activate specific signaling pathways

Researchers must carefully design control experiments that account for potential cross-reactivity between related neuropeptide receptors and consider the possibility of heterodimer formation, which can alter signaling properties.

How do post-translational modifications affect NPR-11 function?

Neuropeptide receptors undergo various post-translational modifications that can significantly impact their function:

  • Glycosylation: Affects receptor trafficking and ligand binding

  • Phosphorylation: Regulates receptor desensitization and internalization

  • Palmitoylation: Influences membrane localization and signaling

  • Ubiquitination: Controls receptor degradation and turnover

Research approaches to study these modifications include:

  • Mass spectrometry to identify specific modifications

  • Mutagenesis of putative modification sites

  • Pharmacological inhibitors of modification enzymes

  • Pulse-chase experiments to track receptor lifecycle

Understanding these modifications provides insight into receptor regulation under different physiological conditions and may reveal potential targets for therapeutic intervention.

What approaches can resolve contradictory findings in NPR-11 research?

Scientific literature often contains seemingly contradictory findings regarding receptor function. Resolution strategies include:

  • Methodological standardization: Ensuring comparable experimental conditions across studies

  • Cell/tissue specificity considerations: Recognizing that receptor function may differ across cell types

  • Isoform characterization: Identifying whether different splice variants or isoforms explain functional differences

  • Comprehensive pharmacological profiling: Testing multiple ligands across concentration ranges

  • Integration of in vitro and in vivo approaches: Validating cell-based findings in physiological contexts

When faced with contradictory data, researchers should systematically evaluate methodological differences, expression system variations, and potential differences in receptor constructs that might explain discrepancies.

How can NPR-11 structural models guide rational drug design?

Structural modeling approaches provide valuable insights for developing ligands with desired pharmacological properties:

  • Homology modeling based on crystal structures of related receptors

  • Molecular dynamics simulations to understand conformational flexibility

  • Docking studies to predict ligand-receptor interactions

  • Structure-activity relationship (SAR) analyses to correlate structural features with activity

Similar to approaches used for other receptors, NPR-11 structural modeling would likely employ homology models of both extracellular and intracellular domains . These models can help predict how mutations affect receptor structure and function, and guide the design of selective ligands. For instance, understanding the ligand-binding pocket architecture can inform the development of agonists or antagonists with improved selectivity profiles.

What are the most promising in vivo models for studying NPR-11 function?

In vivo models provide crucial insights into receptor function in physiological contexts:

  • Knockout/knockin mouse models: Allow assessment of receptor function through targeted genetic manipulation

  • Conditional expression systems: Enable temporal and tissue-specific control of receptor expression

  • CRISPR/Cas9-engineered models: Facilitate precise introduction of specific mutations

  • Optogenetic/chemogenetic approaches: Permit controlled activation of receptor signaling

When developing these models, researchers must consider genetic background effects, potential developmental compensation, and the appropriate physiological readouts to measure receptor-dependent functions.

How does heterologous expression influence NPR-11 pharmacology?

The expression context can significantly impact receptor pharmacology through various mechanisms:

  • Differential G-protein coupling in various cell types

  • Cell-specific scaffolding protein interactions

  • Varying levels of receptor-modifying enzymes

  • Membrane composition differences affecting receptor conformation

For reliable pharmacological characterization, researchers should:

  • Compare receptor properties across multiple expression systems

  • Include appropriate positive controls with well-characterized receptors

  • Validate key findings in native tissues where possible

  • Consider the impact of expression levels on observed pharmacology

Testing receptor function in relevant cell types can help ensure that findings translate to physiological contexts.

What statistical approaches are most appropriate for analyzing NPR-11 functional data?

Rigorous statistical analysis is essential for interpreting receptor pharmacology data:

  • Concentration-response analysis: Typically employs nonlinear regression models to determine EC50/IC50 values

  • Binding studies: Require Scatchard or nonlinear regression analyses to determine affinity constants

  • Signaling pathway comparisons: May employ area-under-curve analyses or kinetic modeling

  • Multiple condition experiments: Often require two-way ANOVA with appropriate post-hoc tests

When analyzing data from receptor studies, researchers should consider:

  • The appropriate statistical distribution (e.g., normal vs. t-distribution)

  • The need for data transformations to meet statistical assumptions

  • Sample size considerations and power calculations

  • Correction for multiple comparisons when appropriate

Statistical approaches similar to those used in other receptor studies, such as employing t-distributions with appropriate degrees of freedom, can be applied to npr-11 research .

How can apparent discrepancies in NPR-11 sequence data be reconciled?

Sequence discrepancies may arise from various sources:

  • Splice variants or alternative promoter usage

  • Sequencing errors or limitations

  • Population polymorphisms

  • Annotation differences across databases

Resolution approaches include:

  • Direct sequencing of receptor cDNA from multiple sources

  • Comparison across database entries with critical evaluation

  • Functional testing of variant sequences

  • Genomic DNA sequencing to confirm exon-intron boundaries

When sequence discrepancies are identified, researchers should document all variants and their sources clearly, and wherever possible, determine the functional significance of the differences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.