Recombinant Putative neutral sphingomyelinase (T27F6.6)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Putative Neutral Sphingomyelinase (T27F6.6)

Recombinant Putative Neutral Sphingomyelinase (T27F6.6) is a protein expressed in E. coli, fused to an N-terminal His tag, and is a full-length form of the enzyme . Sphingomyelinases, including neutral sphingomyelinase (NSM), catalyze the breakdown of sphingomyelin, a major component of cell membranes, influencing the biophysical properties of these membranes . This enzymatic activity is particularly significant in the context of cell signaling, receptor compartmentalization, and membrane protein sorting .

Role in T Cell Function

NSM plays a crucial role in T cell activation, impacting cytoskeletal reorganization and cell polarization . Its activity is important for directional T cell migration and motility in tissues . Studies have shown that inhibiting NSM can interfere with early lymph node homing of T cells in vivo, suggesting its involvement in endothelial adhesion, transendothelial migration, and the sensing of chemokine gradients . NSM inhibition can also reduce T cell adhesion to activated endothelial cells by inhibiting LFA-1 clustering . Furthermore, NSM activity is important for directional T cell motility in response to SDF1-α, influencing the ability of T cells to sense and translate chemokine gradients . NSM ablation can disrupt T cell polarization and the redistribution of CXCR4 and pERM proteins, affecting F-actin polymerization upon SDF1-α stimulation .

Involvement in Ceramide and ROS Production

Neutral sphingomyelinase (nSMase) activity is linked to ceramide production and ROS (reactive oxygen species) formation . Ceramide, produced by nSMase-dependent sphingomyelin hydrolysis, is involved in various cellular processes, including TNFα antagonism of SphK1 activation . Studies using TNFα to stimulate cells showed increased levels of phosphorylated p40 phox and plasma membrane-associated p67 phox, both of which were abolished when nSMase activity was inhibited . Palmitate, which stimulates de novo ceramide synthesis, also increased the level of plasma membrane-associated p67 phox, further implicating ceramide in these processes .

Relevance to Neuroblastoma Cells

In human SH-SY5Y neuroblastoma cells and cortical neurons, a NOX2-like activity has been identified as a source of intracellular ROS formation in response to TNFα . Perturbing ceramide accumulation by inhibiting Mg2+-nSMase-dependent sphingomyelin hydrolysis or de novo ceramide synthesis influenced the levels of p67 phox and phosphorylation of p40 phox . These findings suggest that ceramide-dependent NOX2 activation is relevant in neuronal cells exposed to TNFα .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it; we will prioritize its development.
Synonyms
T27F6.6; Putative neutral sphingomyelinase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-434
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
T27F6.6
Target Protein Sequence
MEPSSEQESQESQKVDMEPVFRRESFAALRRNNVAARQLRVVTLNAWCLPQPWPIGSTDR VHRLNKIGQYMIDELYDIVGLQELWSYYDFVRLSEQVSSVYPYFHYFHSGFTGSGVCVFS RHPIVSTLTNRYSLNGFAHHIHRGDWFGGKVVGLTEIEIDGDLRVNFYTTHLHAEYDREN DLYLPHRTAQAFELAQFVRHTARGADVVIVTGDLNMEPCDLGFRLILSHAKLFDAWRMSH EVENEDSEGELLKFRGIAKGGTCDRPDNCYTKRALKNVDDSKRIDYMLFKSGRCNVKLEE CEITLNQIPGEDLNYSDHVGLRARFTIDDRFRHEKSVNTWEPNRPLLIEAIGLVAGGERR ARTDRIFFFILAVICLILILGSLFFEVFPMGFAVLRFALTVVGVFFVWQGLIGLTLERKA LKAAKQAIQQILNN
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_T27F6.6

STRING: 6239.T27F6.6.1

UniGene: Cel.8884

Protein Families
Neutral sphingomyelinase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Characterization and Function

  • What is T27F6.6 and how is it characterized in C. elegans?

    T27F6.6 is the gene encoding the putative neutral sphingomyelinase in Caenorhabditis elegans. Unlike the three well-characterized acid sphingomyelinases in C. elegans (asm-1, asm-2, and asm-3), T27F6.6 remains largely uncharacterized . The protein consists of 434 amino acids and contains domains characteristic of neutral sphingomyelinases, including catalytic domains that likely participate in sphingomyelin hydrolysis. The putative protein has a Uniprot accession number of O45870 and contains regions responsible for membrane association and catalytic activity . Sphingomyelinases are critical enzymes that convert sphingomyelin to ceramide and are involved in various cellular signaling pathways related to stress responses, apoptosis, and lifespan regulation.

  • What are the basic biochemical properties of T27F6.6 compared to other neutral sphingomyelinases?

    While T27F6.6 itself remains inadequately characterized, neutral sphingomyelinases generally share several biochemical properties that T27F6.6 likely possesses. These enzymes typically:

    • Have a pH optimum around 7.5, distinguishing them from acid sphingomyelinases

    • Require Mg²⁺ for optimal activity

    • Are stimulated by anionic phospholipids such as phosphatidylserine (PS) or cardiolipin

    • Convert sphingomyelin to ceramide while also potentially hydrolyzing other substrates like 1-acyl-2-lyso-sn-glycero-3-phosphocholine (lyso-PC) and 1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine (lyso-platelet-activating factor)

    The kinetic parameters of purified T27F6.6 have not been extensively reported in literature compared to human SMPD2, which has been shown to hydrolyze both sphingomyelin and lyso-PAF with comparable Km values .

  • What methods are commonly used to measure the enzymatic activity of recombinant neutral sphingomyelinases like T27F6.6?

    Several methodological approaches are used to assess sphingomyelinase activity:

    • Fluorescence-based assays: The Amplex Red Sphingomyelinase Assay Kit is widely used to detect enzymatic activity through time-dependent fluorescence signal changes. This method measures fluorescence signals (λexc = 584 nm; λem = 612 nm) at regular intervals for defined periods (typically 1 hour) at 37°C .

    • Colorimetric assays: Changes in color can be assessed after incubating samples at 37°C, providing a simpler but less quantitative measure of activity .

    • Hemolytic activity assays: For sphingomyelinases with hemolytic properties, blood agar plates containing sheep blood can be used. After protein expression (typically in E. coli BL21 (DE3) induced with IPTG), cultures are inoculated onto blood agar plates and incubated at 37°C for approximately 18 hours. Hemolysis is detected by changes in the red color of the blood agar .

    • Mass spectrometry: More advanced studies employ mass spectrometry to directly measure the conversion of sphingomyelin to ceramide and phosphocholine.

    For functional verification, positive controls often include recombinant B. cereus sphingomyelinase, while negative controls might use irrelevant proteins such as S. pyogenes Cas9 .

Advanced Research Topics

  • What structural domains are important for T27F6.6 function based on homology with better-characterized sphingomyelinases?

    Based on structural studies of homologous enzymes like human SMPD2 (hSMPD2), several key domains and residues are likely important for T27F6.6 function:

    • Transmembrane domain (TMD): Critical for maintaining dimeric architecture and proper protein orientation

    • Catalytic domain: Contains essential residues for substrate binding and hydrolysis

    • Loop domains: Particularly important is the equivalent of the D111-K116 loop domain in human SMPD2, which is indispensable for sphingomyelin hydrolysis

    • Metal-binding sites: Likely coordinates Mg²⁺, similar to how N15, E48, E49, and D178 coordinate Mg²⁺ in human SMPD2

    Key catalytic residues identified in human SMPD2 include H272, which helps position the nucleophilic water molecule, and K116, which forms a salt bridge with the phosphate group of sphingomyelin, stabilizing the scissile phosphodiester bond during catalysis . Homologous residues in T27F6.6 would be expected to perform similar functions.

  • How does sphingolipid metabolism involving T27F6.6 influence lifespan and stress responses in C. elegans?

    While T27F6.6 itself has not been extensively studied in the context of lifespan regulation, research on sphingolipid metabolism in C. elegans provides valuable insights:

    • Mutations in acid sphingomyelinase (asm-3) lead to extended lifespans in C. elegans, suggesting sphingomyelinase activity influences aging

    • ASM-3 may interact with the DAF-2/insulin-like growth factor receptor, affecting the nuclear localization of DAF-16/FOXO transcription factor

    • Sphingolipids constitute a major component of membrane microdomains and mediate protein localization, including receptor localization

    • Mutations in ceramide synthesis pathways (hyl-2/ceramide synthase) result in shortened lifespans and hypersensitivity to oxidative stress

    Given these findings, T27F6.6 likely plays a role in stress response pathways and lifespan regulation through modulation of ceramide levels and membrane composition. Investigating T27F6.6 knockouts or mutations could reveal specific effects on stress resistance and longevity in C. elegans.

  • What are the key differences in lipidomic profiles between wild-type C. elegans and strains with altered sphingomyelinase activity?

    Lipidomic analyses have revealed significant differences between wild-type C. elegans and strains with altered sphingolipid metabolism:

    • Wild-type animals show increased triacylglycerols (TAG) and decreased lysophosphatidylcholines (LPC) with age (from day 1 to day 10)

    • Acid sphingomyelinase (asm-3) mutants demonstrate:

      • Fewer TAGs at day 10 compared to wild-type

      • Lipid composition similar to long-lived, caloric restriction model eat-2/mAChR mutants

      • Pronounced decreases in shorter chained saturated free fatty acids (FFAs)

      • Higher total sphingomyelin levels at day 1 but lower levels at day 10 compared to wild-type

    • Ceramide synthase (hyl-2) mutants exhibit:

      • Elevated total polyunsaturated fatty acids (PUFAs)

      • Increased LPCs compared to 10-day wild-type animals

      • Lipid profiles similar to short-lived daf-16/FOXO mutants

      • Poor oxidative stress response

      • Increases in most types of free fatty acids (FFAs) from day 1 to day 10, including shorter chained saturated and unsaturated FFAs

    These differences suggest that T27F6.6 activity would similarly influence lipid profiles, particularly sphingomyelin and ceramide levels, potentially affecting stress responses and lifespan through alterations in membrane composition and signaling lipid availability.

  • What mechanisms regulate T27F6.6 activity at transcriptional and post-translational levels?

    While specific regulatory mechanisms for T27F6.6 have not been extensively characterized, studies on other neutral sphingomyelinases provide insights into likely regulatory pathways:

    Transcriptional regulation:

    • Transcription factors Sp1 and Sp3 activate neutral sphingomyelinase gene transcription in response to stimuli like chemotherapeutics (Daunorubicin, Camptothecin) and All-trans retinoic acid (ATRA)

    • The promoter region approximately 147 bp upstream of exon 1 may be particularly important for transcriptional activation

    Post-translational regulation:

    • Phosphorylation by p38 MAPK, protein kinase C (PKC), and potentially other kinases may regulate enzyme activity

    • Anionic phospholipids (APLs) such as phosphatidylserine (PS), phosphatidic acid, and phosphatidylinositol stimulate neutral sphingomyelinase activity, while neutral lipids like phosphatidylcholine or phosphatidylethanolamine do not

    • Mg²⁺ or Mn²⁺ is required for catalytic activity

    These regulatory mechanisms likely apply to T27F6.6 as well, suggesting multiple levels of control over its enzymatic activity that respond to cellular stress and signaling events.

Biological Significance and Applications

  • How does T27F6.6 contribute to ceramide-mediated signaling pathways?

    While T27F6.6-specific pathways have not been fully elucidated, neutral sphingomyelinases play crucial roles in ceramide-mediated signaling that likely apply to T27F6.6:

    1. Stress response signaling:

      • Activation of neutral sphingomyelinase leads to ceramide generation in response to various stressors

      • Ceramide activates stress-activated protein kinases (SAPKs) and induces cell cycle arrest

    2. Inflammatory signaling:

      • TNFα potently stimulates Mg²⁺-dependent neutral sphingomyelinase activity

      • This leads to ceramide accumulation and subsequent reactive oxygen species (ROS) generation

      • The mechanism involves a NOX2-like NADPH oxidase activation pathway

    3. Growth and apoptotic regulation:

      • Ceramide generated by neutral sphingomyelinases antagonizes sphingosine-1-phosphate (S1P)-mediated survival pathways

      • This creates a "sphingolipid rheostat" that determines cell fate between survival and apoptosis

    4. Exosome biogenesis:

      • Neutral sphingomyelinase 2 (nSMase2) plays a critical role in extracellular vesicle (EV) biogenesis

      • Inhibition of nSMase2 can reduce EV release into plasma, demonstrating its importance in intercellular communication

    In C. elegans specifically, these pathways likely integrate with known longevity mechanisms, as evidenced by the extended lifespan of acid sphingomyelinase (asm-3) mutants and their interaction with the insulin/IGF-1 signaling pathway .

  • What is the relationship between T27F6.6 activity and oxidative stress responses?

    Based on research with related sphingomyelinases, T27F6.6 likely plays an important role in oxidative stress responses through several mechanisms:

    1. Ceramide-induced ROS generation:

      • Ceramide produced by sphingomyelinase activity can stimulate reactive oxygen species (ROS) formation through activation of NADPH oxidases

      • In neuronal cells, TNFα stimulates Mg²⁺-nSMase activity, causing ceramide accumulation and subsequent ROS generation

    2. Oxidative damage amplification:

      • The ceramide-ROS pathway can create a positive feedback loop, where initial ceramide production leads to ROS, which can further stimulate sphingomyelinase activity

      • This has been demonstrated in SH-SY5Y human neuroblastoma cells and primary cortical neurons

    3. Impact on antioxidant systems:

      • Ceramide can impair antioxidant defenses by affecting pathways that regulate glutathione levels

      • This may explain why C. elegans mutants with altered sphingolipid metabolism (like hyl-2) show poor oxidative stress response

    4. NOX2 activation:

      • Ceramide generated by sphingomyelinase activity can promote assembly and activation of the NADPH oxidase complex

      • This involves increased phosphorylation of p40ᵖʰᵒˣ and translocation of p67ᵖʰᵒˣ to the plasma membrane

    These mechanisms suggest that T27F6.6 likely influences C. elegans' ability to respond to oxidative challenges, potentially explaining some of the lifespan effects observed in sphingolipid metabolism mutants.

  • How can inhibitors of T27F6.6 be developed and characterized for research applications?

    Development and characterization of T27F6.6 inhibitors would follow a systematic approach:

    1. Inhibitor design strategies:

      • Structure-based design utilizing homology models based on human SMPD2 structure

      • High-throughput screening of compound libraries against recombinant T27F6.6

      • Modification of known sphingomyelinase inhibitors like GW4869

      • Prodrug approaches similar to those used for DPTIP (a human nSMase2 inhibitor)

    2. Synthesis and initial characterization:

      • Chemical synthesis of candidate compounds

      • Analysis by NMR, HPLC, and mass spectrometry to confirm structure and purity (>95%)

    3. In vitro inhibition assays:

      • Determination of IC₅₀ values using the Amplex Red assay

      • Evaluation of inhibition mechanisms (competitive, non-competitive, uncompetitive)

      • Selectivity testing against other sphingomyelinases (acid sphingomyelinases, other neutral sphingomyelinases)

    4. Structure-activity relationship studies:

      • Systematic modification of lead compounds to improve potency, selectivity, and pharmacokinetic properties

      • Molecular docking and molecular dynamics simulations to understand binding modes

    5. Cellular and in vivo validation:

      • Testing inhibitory activity in C. elegans

      • Assessing effects on sphingolipid metabolism through lipidomic analysis

      • Evaluating phenotypic effects (stress resistance, lifespan)

    The development process would prioritize compounds that specifically target T27F6.6 without affecting other sphingomyelinases, allowing for precise investigation of its biological functions.

Data Tables and Research Findings

  • What are the key differences in sphingolipid profiles during aging in C. elegans with altered sphingomyelinase activity?

    While specific data for T27F6.6 mutants is limited, research on related sphingolipid metabolism enzymes provides valuable insights:

    Table 1: Changes in lipid classes with age in different C. elegans strains

    Lipid ClassWild-type (N2)asm-3 mutanthyl-2 mutant
    Triacylglycerols (TAG)Increases from day 1 to day 10No significant increase from day 1 to day 10Increases from day 1 to day 10
    Lysophosphatidylcholines (LPC)Decreases with ageNot significantly changedIncreased at day 10 compared to wild-type
    Sphingomyelins (SM)General increase with ageHigher at day 1, lower at day 10 compared to wild-typeSimilar pattern to wild-type
    Free Fatty Acids (FFA)Decreases in shorter chained saturated FFAMore pronounced decreases in shorter chained saturated FFAIncreases in most types from day 1 to day 10
    Polyunsaturated Fatty Acids (PUFA)Moderate increase with ageSignificant increases in longer chained FFAsElevated total PUFA compared to wild-type

    These differences suggest that altered sphingomyelinase activity significantly impacts lipid metabolism during aging, potentially explaining the altered lifespan and stress resistance phenotypes observed in these mutants .

  • What catalytic residues are essential for neutral sphingomyelinase activity based on structural studies?

    Based on structural and functional studies of human neutral sphingomyelinase (SMPD2), several key residues are essential for catalytic activity and likely have functional equivalents in T27F6.6:

    Table 2: Key catalytic residues in human SMPD2 and their functions

    ResidueFunctionEffect of Mutation
    D111Part of essential loop domainD111A mutation results in drastically reduced sphingomyelin hydrolysis
    H109Structural integrityH109A mutation leads to reduced expression and attenuated catalytic activity
    K116Forms lysine-phosphate salt bridge with sphingomyelinK116A mutation drastically reduces sphingomyelin hydrolysis
    Y103Structural integrityY103A mutation results in inefficient expression and dramatically attenuated activity
    S114Non-criticalS114A mutation has minimal effect on sphingomyelin hydrolysis
    H272Positions nucleophilic water moleculeEssential for catalysis
    N15, E48, E49, D178Coordinate Mg²⁺ ionCritical for metal ion binding and catalytic function

    Molecular dynamics simulations have revealed that K116 undergoes a noticeable rearrangement to form a salt bridge with the binding sphingomyelin, and this interaction is maintained throughout the simulation, indicating its essential role in stabilizing the scissile phosphate at the catalytic center .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.