Recombinant Putative peptide transport permease protein Mb1313c (Mb1313c)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Transport Systems

Mb1313c is annotated as OppC, a permease component of the oligopeptide ABC transporter (Opp). Key functional insights include:

  • Mechanism: Collaborates with ATP-binding proteins to transport oligopeptides across the cytoplasmic membrane using energy from ATP hydrolysis .

  • Structural Motifs: Contains conserved transmembrane helices critical for forming substrate channels, analogous to other bacterial Opp systems .

  • Biological Significance: Essential for nutrient uptake in Mycobacterium species, potentially influencing pathogenesis by importing bioactive peptides .

Functional Assays

  • Peptide Transport: Used to characterize substrate specificity using radiolabeled peptides or fluorogenic probes .

  • Drug Resistance Studies: Knockout mutants of Opp systems in Mycobacteria show impaired growth under peptide-limited conditions .

Technical Considerations

Expression Challenges:

  • Requires codon optimization for stable expression in E. coli due to hydrophobic transmembrane regions .

  • Lyophilization preserves activity but mandates glycerol supplementation for long-term storage .

Validation Methods:

  • Binding Assays: Surface plasmon resonance (SPR) with synthetic oligopeptides .

  • Transport Kinetics: Membrane vesicle-based uptake studies measuring KmK_m and VmaxV_{max} .

Comparative Analysis with Related Transporters

FeatureMb1313c (OppC)S. pneumoniae AmiDE. coli YdgR
Transport TypeABC ImporterABC ImporterPTR Symporter
Energy SourceATP HydrolysisATP HydrolysisProton Gradient
Substrate Size2–5 residues5–10 residues2–3 residues
Membrane Topology6–10 TMDs6 TMDs12 TMDs

Outstanding Research Questions

  1. Does Mb1313c interact with extracellular substrate-binding proteins (SBPs) like AmiA in S. pneumoniae ?

  2. What regulatory mechanisms control its expression during Mycobacterium infection?

  3. Can structural data (e.g., cryo-EM) resolve conformational changes during peptide transport ?

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
BQ2027_MB1313C; Putative peptide transport permease protein Mb1313c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB1313C
Target Protein Sequence
MTEFASRRTLVVRRFLRNRAAVASLAALLLLFVSAYALPPLLPYSYDDLDFNALLQPPGT KHWLGTNALGQDLLAQTLRGMQKSMLIGVCVAVISTGIAATVGAISGYFGGWRDRTLMWV VDLLLVVPSFILIAIVTPRTKNSANIMFLVLLLAGFGWMISSRMVRGMTMSLREREFIRA ARYMGVSSRRIIVGHVVPNVASILIIDAALNVAAAILAETGLSFLGFGIQPPDVSLGTLI ADGTASATAFPWVFLFPASILVLILVCANLTGDGLRDALDPASRSLRRGVR
Uniprot No.

Target Background

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Putative peptide transport permease protein Mb1313c and what is its role in Mycobacterium bovis?

Putative peptide transport permease protein Mb1313c (also known as OppC) is an integral membrane component of the oligopeptide ABC transporter system in Mycobacterium bovis. This protein functions as a transmembrane permease that facilitates the movement of peptides across the bacterial membrane. As part of the ATP-binding cassette (ABC) transporter family, it utilizes energy from ATP hydrolysis to transport peptides, which are essential for bacterial nutrition and metabolism . The protein consists of 291 amino acids and plays a crucial role in nutrient acquisition, allowing the bacterium to import peptides from the extracellular environment for use as nutrients and building blocks for protein synthesis .

How does the Mb1313c protein differ from other peptide transporters in bacteria?

The Mb1313c protein belongs to the ATP-binding cassette (ABC) transporter family, which is one of two major categories of peptide transporters in bacteria. Unlike proton-coupled peptide transporters (POT or PTR family) that rely on proton motive force for peptide transport, ABC transporters like Mb1313c utilize ATP hydrolysis through coordination between multiple proteins .

The key differences include:

FeatureABC Transporters (Mb1313c)Proton-Coupled Transporters
Energy SourceATP hydrolysisProton motive force
StructureMulti-component system with separate ATPase, permease, and substrate-binding proteinsSingle transmembrane proteins
Transport CapacityGenerally higher affinity, lower capacityVariable affinity and capacity
Substrate SpecificityOften more specificCan be broad or specific

Mb1313c specifically functions within the Opp (oligopeptide transport) system, which is specialized for the uptake of oligopeptides of varying lengths. This system has been implicated in virulence mechanisms in various bacterial pathogens, highlighting the dual role of these transporters in both nutrition and pathogenesis .

What expression systems are most effective for producing recombinant Mb1313c protein?

Multiple expression systems have been successfully employed for the production of recombinant Mb1313c protein, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, simple scale-upMay require optimization for membrane proteins
YeastEukaryotic processing, good for complex proteinsLonger production time, potential glycosylation
BaculovirusHigh expression of functional membrane proteinsMore complex setup, higher cost
Mammalian CellNative-like post-translational modificationsMost expensive, lower yields
Cell-Free ExpressionRapid production, avoids toxicity issuesLimited scale, potentially higher cost

For Mb1313c specifically, E. coli expression systems have been successfully used to produce the recombinant protein with greater than 90% purity as determined by SDS-PAGE . This system allows for fusion with tags such as His-tags to facilitate purification. When designing experiments involving this protein, researchers should consider that the expression system may affect protein folding, activity, and yield, necessitating optimization for specific research objectives .

What are the optimal storage and handling conditions for recombinant Mb1313c protein?

For optimal preservation of recombinant Mb1313c protein activity and structure, the following storage and handling conditions are recommended:

  • Storage temperature: Store at -20°C/-80°C upon receipt, with -80°C being preferable for long-term storage .

  • Aliquoting: Divide the protein into small aliquots to prevent repeated freeze-thaw cycles, which can significantly degrade protein quality .

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week .

  • Storage buffer: The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability .

  • Reconstitution: For lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Cryoprotection: Addition of 5-50% glycerol (with 50% being standard) is recommended for long-term storage to prevent ice crystal formation and protein denaturation .

Proper handling significantly impacts experimental outcomes. For optimal results, centrifuge vials briefly before opening to ensure all material is at the bottom, avoid repeated freeze-thaw cycles, and maintain sterile conditions during handling to prevent contamination .

What experimental controls should be included when studying Mb1313c function?

When designing experiments to study Mb1313c function, incorporating appropriate controls is essential for valid interpretation of results:

  • Negative controls:

    • Empty vector or mock-transfected cells to control for expression system effects

    • Heat-inactivated Mb1313c protein to distinguish between specific activity and non-specific effects

    • Samples lacking ATP to confirm ATP-dependency of transport function

  • Positive controls:

    • Well-characterized ABC transporter proteins with known function

    • Known peptide substrates that have established transport kinetics

    • Functional assays with validated readouts for ABC transporter activity

  • Specificity controls:

    • Competitive inhibitors of peptide transport to confirm specificity

    • Structurally similar but non-substrate peptides to establish selectivity

    • Site-directed mutants with altered binding or hydrolysis capabilities

When designing these experiments, it's critical to clearly define your experimental variables including independent variables (such as substrate concentration, ATP availability) and dependent variables (transport rate, binding affinity) . This approach allows for rigorous assessment of Mb1313c function while controlling for confounding factors that might influence experimental outcomes .

How can researchers investigate the role of Mb1313c in bacterial virulence?

Investigating the relationship between Mb1313c and bacterial virulence requires a multifaceted approach:

  • Gene knockout studies:

    • Generate Mb1313c knockout strains of Mycobacterium bovis

    • Compare virulence phenotypes between wild-type and knockout strains in appropriate animal models

    • Evaluate impacts on colonization, persistence, and tissue damage

  • Gene expression analysis:

    • Quantify Mb1313c expression under infection-mimicking conditions

    • Use RNA-seq or qPCR to determine if expression is upregulated during infection

    • Identify co-regulated genes that might participate in virulence mechanisms

  • Protein-peptide interaction studies:

    • Identify specific peptides transported by Mb1313c during infection

    • Determine if these peptides contribute to bacterial survival or host immune evasion

    • Characterize the kinetics of peptide transport during different infection stages

  • Host-pathogen interaction assays:

    • Evaluate the impact of Mb1313c on bacterial survival within macrophages

    • Assess changes in host immune response when Mb1313c is present versus absent

    • Determine if Mb1313c-mediated peptide transport affects bacterial persistence

These approaches can reveal how Mb1313c's peptide transport function contributes to virulence by mediating the cross-connection between metabolism and pathogenesis . Since bacterial peptide transporters are consistently reported to play roles in virulence of various bacterial pathogens, understanding Mb1313c's specific contribution could lead to novel therapeutic strategies targeting this protein .

What methodologies can be used to study the structure-function relationship of Mb1313c?

Exploring the structure-function relationship of Mb1313c requires combining structural biology techniques with functional assays:

  • Structural determination methods:

    • X-ray crystallography of purified Mb1313c protein to determine high-resolution structure

    • Cryo-electron microscopy (cryo-EM) to visualize the protein in different conformational states

    • Nuclear Magnetic Resonance (NMR) spectroscopy for dynamic structural information

  • Computational approaches:

    • Homology modeling based on related ABC transporters with known structures

    • Molecular dynamics simulations to predict conformational changes during transport cycle

    • Docking studies to identify potential peptide binding sites

  • Functional mapping techniques:

    • Site-directed mutagenesis of key residues identified from structural studies

    • Chimeric protein construction by swapping domains with related transporters

    • Accessibility studies using cysteine-scanning mutagenesis and membrane-impermeable reagents

  • Biophysical characterization:

    • Isothermal titration calorimetry (ITC) to measure binding affinities for different peptides

    • Fluorescence spectroscopy to monitor conformational changes upon substrate binding

    • Surface plasmon resonance (SPR) to study real-time binding kinetics

These approaches can elucidate how specific structural elements of Mb1313c contribute to substrate recognition, binding, and transport across the membrane. Understanding these structure-function relationships could facilitate the development of specific inhibitors targeting Mb1313c and related peptide transporters in pathogenic bacteria .

How can researchers investigate the potential of Mb1313c as a target for antimicrobial therapy?

Investigating Mb1313c as a potential antimicrobial target involves several strategic research approaches:

  • Target validation studies:

    • Determine essentiality of Mb1313c for bacterial survival using conditional knockdown systems

    • Evaluate whether inhibition affects bacterial growth in various nutrient environments

    • Assess if Mb1313c is required during different stages of infection

  • High-throughput screening:

    • Develop functional assays suitable for screening compound libraries

    • Measure peptide transport activity in reconstituted systems or whole cells

    • Identify hit compounds that specifically inhibit Mb1313c function

  • Structure-based drug design:

    • Utilize structural information to design compounds that bind to critical functional sites

    • Perform in silico docking studies to predict binding affinities of potential inhibitors

    • Optimize lead compounds based on structure-activity relationships

  • Therapeutic potential assessment:

    • Evaluate cytotoxicity of lead compounds against mammalian cells

    • Determine antimicrobial activity against Mycobacterium bovis and related pathogens

    • Assess development of resistance and potential cross-resistance mechanisms

Given that peptide transporters have implications in antibacterial therapy and have been linked to virulence in bacterial pathogens, Mb1313c represents a potentially valuable target . The ability to selectively inhibit bacterial peptide transport without affecting host processes could provide a novel approach to combating Mycobacterium bovis infections with potentially fewer side effects than conventional antibiotics .

What are common challenges in purifying active Mb1313c protein and how can they be addressed?

Researchers frequently encounter several challenges when purifying active Mb1313c protein, which is a membrane protein:

ChallengePotential SolutionImplementation Strategy
Low expression levelsOptimize codon usageAdapt codons to match expression host preferences
Use stronger promotersReplace standard promoters with high-efficiency alternatives
Adjust induction conditionsTest different inducer concentrations and induction times
Protein aggregationModify detergent conditionsScreen multiple detergents at varying concentrations
Add stabilizing agentsInclude glycerol, specific lipids, or stabilizing ligands
Lower expression temperatureReduce to 16-18°C to slow folding and prevent aggregation
Protein inactivityPreserve native lipid environmentUse gentler solubilization methods or nanodiscs
Optimize purification bufferTest different pH values, salt concentrations, and additives
Minimize oxidationInclude reducing agents and perform purification at 4°C
Proteolytic degradationAdd protease inhibitorsInclude a comprehensive protease inhibitor cocktail
Reduce purification timeStreamline protocol to minimize exposure time
Use specific host strainsSelect strains with reduced protease activity

For Mb1313c specifically, E. coli expression systems have been successfully used to produce protein with greater than 90% purity . When troubleshooting purification issues, it's advisable to analyze each step with analytical techniques such as Western blotting and activity assays to identify where protein loss or inactivation occurs. Adjusting the His-tag position or switching to alternative affinity tags may also improve purification outcomes .

How can researchers accurately interpret transport assays involving Mb1313c?

Accurate interpretation of transport assays for Mb1313c requires careful consideration of several factors:

  • Assay system selection:

    • Reconstituted proteoliposomes: Provide a controlled environment but may lack cellular components

    • Membrane vesicles: Retain native membrane environment but contain other transporters

    • Whole-cell assays: Most physiologically relevant but most complex to interpret

  • Critical controls for valid interpretation:

    • ATP-depleted samples to confirm ATP-dependence of transport

    • Competitive inhibition assays to establish substrate specificity

    • Temperature-dependent kinetics to distinguish transport from binding

  • Data analysis considerations:

    • Initial rate measurements: Focus on linear portion of uptake curve to determine true transport rates

    • Saturation kinetics: Analyze using appropriate models (Michaelis-Menten, Hill equation)

    • Statistical analysis: Apply appropriate statistical tests based on experimental design

  • Common misinterpretations to avoid:

    • Confusing binding with transport: Distinguish between substrate association and translocation

    • Ignoring background transport: Account for passive diffusion or activity of other transporters

    • Overlooking cooperativity: Test for potential allosteric effects or multiple binding sites

What approaches can resolve conflicting data regarding Mb1313c substrate specificity?

When faced with conflicting data about Mb1313c substrate specificity, researchers should implement a systematic resolution strategy:

  • Methodological standardization:

    • Compare experimental conditions across studies (pH, temperature, buffer composition)

    • Standardize protein preparation methods to ensure consistent protein conformations

    • Use identical substrate concentrations and presentation methods across experiments

  • Complementary techniques approach:

    • Direct binding assays: Isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR)

    • Functional transport assays: Radioisotope or fluorescence-based transport measurements

    • Competition assays: Displacement studies with putative substrates

    • Structural studies: Co-crystallization with potential substrates

  • Systematic variable isolation:

    • Test environmental factors (pH, ion concentrations) that might affect substrate specificity

    • Examine post-translational modifications that could alter binding characteristics

    • Investigate potential allosteric regulators that might modify substrate preferences

  • Collaborative validation:

    • Establish multi-laboratory testing of identical protein preparations

    • Implement blinded experimental designs to minimize bias

    • Develop consensus protocols for substrate specificity determination

By integrating data from multiple methodological approaches and carefully controlling experimental variables, researchers can develop a more comprehensive understanding of true Mb1313c substrate preferences. This systematic approach helps distinguish between genuine biological complexity (such as context-dependent substrate preferences) and methodological artifacts .

How is research on Mb1313c contributing to our understanding of bacterial peptide transport systems?

Research on Mb1313c is providing valuable insights into bacterial peptide transport systems through several key contributions:

  • Evolutionary conservation and specialization:

    • Comparative genomic analyses of Mb1313c and homologs across different bacterial species reveal evolutionary patterns in peptide transport systems

    • Studies of Mb1313c structure-function relationships illuminate how peptide transporters have adapted to specific ecological niches

    • Understanding the conservation of critical functional domains helps identify universal principles of peptide transport

  • Mechanistic insights:

    • Structural studies of Mb1313c contribute to our understanding of the conformational changes that occur during the transport cycle

    • Kinetic analyses reveal how ATP hydrolysis is coupled to substrate translocation across the membrane

    • Identification of specificity determinants helps explain how these transporters recognize and discriminate between different peptides

  • Physiological significance:

    • Research on Mb1313c's role in Mycobacterium bovis reveals how peptide acquisition contributes to bacterial nutrition and growth

    • Studies linking Mb1313c to virulence enhance our understanding of the connection between metabolism and pathogenesis

    • Investigations of regulatory mechanisms demonstrate how bacteria modulate peptide transport in response to environmental signals

These contributions are significant because bacterial peptide transporters represent a crucial nexus between nutrition and virulence . The knowledge gained from studying Mb1313c not only advances our fundamental understanding of bacterial physiology but also has practical applications in developing new strategies to combat bacterial infections .

What emerging technologies are advancing research on membrane proteins like Mb1313c?

Several cutting-edge technologies are transforming research on membrane proteins like Mb1313c:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy (cryo-EM): Enables visualization of membrane proteins in native-like environments without crystallization

    • Micro-electron diffraction (MicroED): Allows structure determination from microcrystals too small for traditional X-ray crystallography

    • Serial femtosecond crystallography: Uses X-ray free-electron lasers to determine structures from nanocrystals at room temperature

  • Membrane mimetic systems:

    • Nanodiscs: Provide a more native-like lipid environment than detergent micelles

    • Lipidic cubic phase (LCP): Facilitates crystallization of membrane proteins in a lipid bilayer environment

    • Cell-free membrane protein expression directly into artificial membranes: Bypasses difficulties of membrane insertion

  • Single-molecule techniques:

    • Single-molecule FRET: Monitors conformational changes during the transport cycle

    • Magnetic tweezers: Measures force generation during substrate translocation

    • Nanopore-based sensing: Detects substrate binding and transport events in real-time

  • Computational approaches:

    • AlphaFold and RoseTTAFold: AI-based structural prediction tools specifically trained on membrane proteins

    • Enhanced sampling molecular dynamics: Simulates rare conformational transitions relevant to transport

    • Deep learning approaches for predicting protein-ligand interactions: Facilitates virtual screening of potential substrates or inhibitors

These technologies collectively enable researchers to overcome traditional challenges in membrane protein research, such as low expression levels, difficult purification, and conformational heterogeneity. For Mb1313c specifically, these advances could accelerate our understanding of its structure, function, and potential as a therapeutic target .

What are the potential applications of Mb1313c research beyond understanding basic bacterial physiology?

Research on Mb1313c has several promising applications that extend beyond fundamental bacterial physiology:

  • Antimicrobial drug development:

    • Target-based drug design: Using structural information about Mb1313c to design specific inhibitors

    • Peptide-mimetic compounds: Developing molecules that competitively inhibit natural substrate transport

    • Combination therapies: Identifying synergistic effects between Mb1313c inhibitors and existing antibiotics

  • Diagnostic applications:

    • Biomarker development: Using Mb1313c or its substrates as indicators of Mycobacterium bovis infection

    • Rapid detection methods: Developing antibody-based or aptamer-based sensors for Mb1313c

    • Strain typing: Utilizing natural variations in Mb1313c to distinguish between bacterial strains

  • Biotechnological applications:

    • Drug delivery systems: Adapting Mb1313c or derived peptides for targeted delivery of antimicrobial compounds

    • Biosensor development: Using Mb1313c as a component in systems designed to detect specific peptides

    • Protein engineering: Creating modified transporters with novel substrate specificities for biotechnological processes

  • Vaccine development:

    • Subunit vaccines: Using Mb1313c as an antigen for vaccine development against Mycobacterium bovis

    • Attenuated strains: Creating Mb1313c-modified strains with reduced virulence for live vaccines

    • Adjuvant development: Utilizing Mb1313c-derived peptides as immunomodulatory components

These applications highlight how research on bacterial peptide transporters like Mb1313c has broad implications beyond basic science, potentially contributing to significant advances in medicine, diagnostics, and biotechnology . The connection between peptide transport and virulence makes Mb1313c particularly relevant for developing novel approaches to combat bacterial infections in both humans and animals .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.