Recombinant Putative peptide transport permease protein Rv1282c/MT1319 (Rv1282c, MT1319)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mycobacterium tuberculosis

Rv1282c/MT1319 functions as part of the Opp ABC transporter system, critical for importing oligopeptides that regulate bacterial signaling and lipid metabolism. Key findings include:

Regulatory Impact on Lipid Biosynthesis

  • Modulation of Virulence Lipids: Opp disruption alters the ratio of mycolic acids to phthiocerol dimycocerosates (PDIMs), both essential for Mtb cell wall integrity and host immune evasion .

  • Transcriptional Control: The Opp system regulates genes encoding PE-family proteins and enzymes involved in triacylglycerol metabolism .

Infection Dynamics

  • Chronic Phase Survival: Opp-deficient Mtb strains exhibit reduced bacterial burden in murine models during chronic infection but cause delayed mortality, suggesting a nuanced role in virulence .

Table 1: Key Experimental Observations

Study FocusMethodologyOutcomeCitation
Lipid Profile AlterationsTLC and MALDI-TOF-MSOpp mutants showed disrupted PDIM and triacylglycerol accumulation
Drug ResistanceGenome-wide association studiesVariants near Rv1282c correlate with altered MIC for clofazimine
Antimicrobial SensitivityBialaphos uptake assayOpp inactivation confers resistance due to impaired peptide transport

Recombinant Protein Applications

This recombinant protein is utilized in:

  • Structural Studies: Investigating transmembrane topology and substrate-binding mechanisms .

  • Drug Discovery: Screening for inhibitors targeting peptide transport in Mtb .

  • Antibody Development: Generating antibodies for Opp system characterization in clinical isolates .

Technical Considerations

  • Reconstitution: Solubilize in sterile water (0.1–1.0 mg/mL) with 50% glycerol for long-term stability .

  • Activity Validation: Functional assays (e.g., ATPase activity, oligopeptide uptake) are recommended due to variability in recombinant protein behavior .

Pathophysiological Implications

The Opp system’s role in lipid remodeling and chronic infection highlights Rv1282c/MT1319 as a potential target for disrupting Mtb’s adaptive strategies. Its association with drug resistance further underscores its relevance in tuberculosis therapeutics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have any specific requirements for the format, please include your request in the order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Target Names
Rv1282c, MT1319
Target Protein Sequence
MTEFASRRTLVVRRFLRNRAAVASLAALLLLFVSAYALPPLLPYSYDDLDFNALLQPPGT KHWLGTNALGQDLLAQTLRGMQKSMLIGVCVAVISTGIAATVGAISGYFGGWRDRTLMWV VDLLLVVPSFILIAIVTPRTKNSANIMFLVLLLAGFGWMISSRMVRGMTMSLREREFIRA ARYMGVSSRRIIVGHVVPNVASILIIDAALNVAAAILAETGLSFLGFGIQPPDVSLGTLI ADGTASATAFPWVFLFPASILVLILVCANLTGDGLRDALDPASRSLRRGVR
Uniprot No.

Q&A

What is Rv1282c/MT1319 and what is its role in Mycobacterium tuberculosis?

Rv1282c/MT1319 is a putative peptide transport permease protein encoded by the Mycobacterium tuberculosis genome. It belongs to the ATP-binding cassette (ABC) transporter superfamily, which are multicomponent transport systems that use ATP hydrolysis to facilitate the translocation of substrates across the cytoplasmic membrane. These systems typically consist of five proteins: extracytoplasmic components for substrate binding, membrane-bound permeases for translocation, and cytoplasmic proteins for ATP hydrolysis . In M. tuberculosis, this protein is part of the oligopeptide permease (Opp) system involved in nutrient acquisition and potentially in virulence mechanisms.

How does Rv1282c relate to other peptide permeases in mycobacteria?

Rv1282c functions as part of the Opp operon in M. tuberculosis, similar to the Opp system described in M. bovis BCG. The most common peptide transporters found among bacteria are binding protein-dependent permeases that use high-energy phosphate bonds during transport . Comparative genomic analysis suggests that Rv1282c shares structural and functional similarities with OppC in related mycobacterial species. These transport systems typically include components encoded within an operon structure, with Rv1282c serving as one of the membrane-bound permease components that mediates passage of peptides through the membrane following conformational changes initiated by ATP hydrolysis .

What is the genetic organization of the operon containing Rv1282c?

The genetic organization of the operon containing Rv1282c follows a structure similar to other ABC transporter operons in mycobacteria. Based on genomic analyses, the Opp operon typically contains genes encoding substrate-binding proteins (similar to OppA), membrane-spanning proteins (OppB and OppC), and ATP-binding proteins (OppD and OppF) . The Rv1282c gene is likely positioned within this operon structure alongside other genes encoding functional components of the peptide transport system. In related mycobacterial species, the Opp operon has been studied using targeted genetic approaches, including the identification of cosmid libraries containing the operon sequences and subsequent cloning of operonic fragments, as demonstrated with the 4.5-kb EcoRI fragment encompassing part of the Opp operon (Rv1280c to Rv1283c) in M. bovis BCG .

What are the recommended methods for expressing and purifying recombinant Rv1282c protein?

For expressing and purifying recombinant Rv1282c protein, researchers should consider a systematic approach involving:

  • Gene cloning: Amplify the Rv1282c gene using PCR with specific primers designed based on the M. tuberculosis H37Rv genome sequence. The amplified gene can then be inserted into an appropriate expression vector containing an affinity tag (such as His-tag) for purification.

  • Expression system selection: E. coli BL21(DE3) or similar strains are commonly used for recombinant mycobacterial protein expression. For membrane proteins like Rv1282c, consider specialized E. coli strains designed for membrane protein expression or mycobacterial expression systems for more native-like folding.

  • Optimized expression conditions: Test multiple induction temperatures (16-37°C), inducer concentrations, and induction durations to optimize expression while minimizing inclusion body formation.

  • Membrane protein extraction: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) to solubilize the membrane protein while maintaining its native conformation.

  • Purification: Employ immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography (SEC) to achieve high purity.

For functional studies, reconstitution of the purified protein into proteoliposomes may be necessary to evaluate transport activity using fluorescent or radiolabeled substrates.

How can I create knockout or mutant strains of Rv1282c for functional studies?

Creating knockout or mutant strains of Rv1282c involves several methodological approaches:

  • Homologous recombination: This can be achieved by constructing a plasmid containing Rv1282c sequences interrupted with an antibiotic resistance cassette. For example, in related studies, researchers interrupted the oppD gene at the ClaI site with a 3.4-kb kanamycin-streptomycin antibiotic cassette and linearized the plasmid with restriction enzymes prior to transformation .

  • Specialized transduction: Using mycobacteriophage-based methods to deliver the knockout construct with higher efficiency.

  • CRISPR-Cas9 systems: Recently adapted for mycobacteria, these provide precise genome editing capabilities.

  • Confirmation of mutants: PCR, Southern blotting, and whole-genome sequencing can verify successful gene disruption or modification.

  • Complementation studies: To confirm phenotypes are specifically due to Rv1282c disruption, complement the mutation with a functional copy of the gene expressed from an integrative or replicative plasmid.

Phenotypic analysis of mutants should include growth studies in media containing various peptides as sole nitrogen or carbon sources, as well as resistance profiling against toxic peptides such as glutathione, which has been used successfully to characterize peptide uptake in opp mutants .

What methods are effective for studying the structure-function relationship of Rv1282c?

Studying the structure-function relationship of Rv1282c requires multiple complementary approaches:

  • Homology modeling and in silico analysis:

    • Sequence retrieval from databases like NCBI

    • Homologue identification using BLASTp

    • Structure prediction using servers like I-TASSER

    • Model selection based on C-score values

    • Validation of tertiary structure through established metrics

  • Site-directed mutagenesis:

    • Targeting conserved residues in transmembrane domains

    • Altering putative substrate-binding sites

    • Modifying residues involved in interaction with ATP-binding components

  • Molecular dynamics (MD) simulation:

    • Using GROMACS with appropriate force fields (e.g., GROMOS96 43a1)

    • Generating topology and coordinates for the protein

    • System solvation in simple point charge (SPC) in appropriate box dimensions

    • Running equilibration phases (NVT and NPT) followed by extended MD simulation (≥100 ns)

    • Analyzing hydrogen bond occupancy using visual molecular dynamics (VMD)

  • Functional assays:

    • Transport assays using radioactive or fluorescent peptide substrates

    • Growth inhibition studies using toxic peptides like glutathione

    • Substrate specificity profiling with various peptides

These methodologies provide comprehensive insights into structure-function relationships by correlating structural elements with functional outcomes.

How can I determine the substrate specificity of Rv1282c?

Determining the substrate specificity of Rv1282c requires multiple experimental approaches:

  • Growth phenotype analysis:

    • Testing growth of wild-type and Rv1282c-mutant strains in media containing various peptides (di-, tri-, tetra-, penta-, and hexapeptides) as sole carbon or nitrogen sources

    • Comparative growth curve analysis in different peptide concentrations

    • Note that in related studies with M. bovis BCG Opp system, researchers tested 25 peptides of varying lengths, though none supported measurable growth as sole carbon sources in either wild-type or mutant strains

  • Competitive inhibition assays:

    • Using known substrates labeled with radioisotopes or fluorophores

    • Measuring transport inhibition by unlabeled potential substrates

    • Determining IC50 values for various peptides

  • Resistance to toxic peptides:

    • Exploiting the resistance of permease mutants to toxic substrates

    • Testing compounds like glutathione (γ-glutamyl-l-cyteinylglycine [GSH]), which is toxic to wild-type mycobacteria

    • Comparing growth inhibition between wild-type and mutant strains at varying concentrations (e.g., wild-type M. bovis BCG is inhibited at 2 mM GSH while opp mutants resist up to 10 mM)

  • Direct transport assays:

    • Using radiolabeled peptides to measure uptake kinetics

    • Determining Km and Vmax values for confirmed substrates

    • Comparing uptake in membrane vesicles prepared from wild-type and mutant strains

Substrate TypeExample CompoundsTesting MethodExpected Outcome in WT vs. Mutant
Toxic peptidesGlutathione (GSH)Growth inhibitionGrowth inhibition in WT at ≥2 mM; Resistance in mutant up to 10 mM
Di/tripeptidesVarious combinationsTransport assaysReduced uptake in mutant compared to WT
Longer peptides (4-6 aa)Various combinationsGrowth complementationPotential differential utilization patterns
Modified peptidesS-nitrosoglutathioneCytotoxicity assaysDifferent susceptibility patterns

What is the relationship between Rv1282c and ATP hydrolysis in peptide transport?

The relationship between Rv1282c and ATP hydrolysis in peptide transport follows the mechanistic principles of ABC transporters:

  • Functional cooperation: Rv1282c functions as a transmembrane permease component that works in concert with ATP-binding proteins (like OppD and OppF). The energy-requiring step in the transport process is ATP hydrolysis by the ATP-binding subunit, which induces conformational changes transmitted to membrane-bound components like Rv1282c .

  • Conformational coupling: ATP binding and hydrolysis by the nucleotide-binding domains induce conformational changes in the permease domains, including Rv1282c, facilitating substrate translocation through alternating access mechanisms.

  • Experimental approaches to study this relationship include:

    • ATPase assays: Measuring ATP hydrolysis rates in membrane preparations containing Rv1282c and associated ATP-binding proteins

    • Non-hydrolyzable ATP analogs: Using these to trap the transporter in specific conformational states

    • Mutations in the ATP-binding component: Analyzing how these affect peptide transport through the Rv1282c permease channel

In ABC transporters, including the Opp system containing Rv1282c, the conformational change resulting from ATP hydrolysis is transmitted to the membrane-bound components that mediate passage through the membrane, highlighting the critical role of energy coupling in this transport process .

What methods can be used to study the interaction between Rv1282c and other components of the ABC transporter complex?

Studying interactions between Rv1282c and other components of the ABC transporter complex requires multiple biochemical and biophysical approaches:

  • Co-immunoprecipitation (Co-IP):

    • Using antibodies against Rv1282c or epitope-tagged versions of the protein

    • Identifying interacting partners by mass spectrometry

    • Confirming specific interactions through reverse Co-IP with antibodies against other Opp components

  • Bacterial two-hybrid system:

    • Constructing fusion proteins with complementary fragments of a reporter protein

    • Detecting protein-protein interactions through reporter gene activation

    • Mapping interaction domains through truncation mutants

  • Surface plasmon resonance (SPR):

    • Immobilizing purified Rv1282c on a sensor chip

    • Measuring binding kinetics with other purified components

    • Determining association and dissociation constants

  • Chemical cross-linking:

    • Using bifunctional cross-linking reagents to stabilize transient interactions

    • Identifying cross-linked products by mass spectrometry

    • Mapping interaction sites at the amino acid level

  • Fluorescence resonance energy transfer (FRET):

    • Creating fluorescent protein fusions with Rv1282c and potential partners

    • Detecting proximity through energy transfer between fluorophores

    • Visualizing interactions in live cells or reconstituted systems

  • Complementation studies in mutant strains:

    • Creating genomic mutations in different components of the Opp system

    • Testing functional complementation patterns

    • Identifying genetic interactions through phenotypic analysis

These methods can comprehensively characterize the dynamic interactions within the oligopeptide permease complex, elucidating how Rv1282c cooperates with substrate-binding proteins, other membrane-spanning components, and ATP-binding proteins to facilitate peptide transport.

How does Rv1282c contribute to M. tuberculosis virulence and pathogenesis?

The contribution of Rv1282c to M. tuberculosis virulence and pathogenesis can be understood through several mechanisms:

  • Nutrient acquisition: As a component of the peptide transport system, Rv1282c likely facilitates the uptake of peptides as nutrient sources within the nutrient-limited host environment, supporting bacterial survival and persistence.

  • Immune evasion: Peptide transporters may contribute to cell wall remodeling or modification in response to host environmental cues, potentially altering antigen presentation or recognition by immune cells.

  • Stress adaptation: The ability to import specific peptides could contribute to stress responses by providing building blocks for protective molecules or signaling peptides important for adaptation to host-induced stresses.

  • Research approaches to investigate these roles include:

    • Infection models: Comparing virulence of wild-type and Rv1282c-mutant strains in cellular and animal models

    • Transcriptional profiling: Analyzing expression changes in Rv1282c under various infection-relevant conditions

    • Metabolomics: Identifying peptides transported by the system during infection

  • Experimental evidence from related systems: Studies of peptide permeases in related bacterial pathogens have demonstrated roles in virulence, and similar mechanisms may apply to the Rv1282c-containing transporter in M. tuberculosis.

Researchers should note that while direct evidence specifically for Rv1282c may be limited, studies on related peptide transport systems in other bacterial pathogens provide valuable insights that can guide experimental approaches.

Can Rv1282c be targeted for drug development against tuberculosis?

Rv1282c represents a potential target for drug development against tuberculosis for several reasons:

  • Essential function: If Rv1282c is involved in critical nutrient acquisition pathways, inhibiting its function could impair bacterial survival and growth.

  • Unique structure: As a membrane protein with features distinct from human transporters, it offers the potential for selective targeting.

  • Drug development approaches include:

    • High-throughput screening: Testing compound libraries for inhibitors of peptide transport

    • Structure-based drug design: Using homology models similar to those developed for related proteins like Rv1250

    • Molecular docking: Performing in silico docking studies to identify potential binding sites and inhibitors

  • Validation methods:

    • Transport inhibition assays: Measuring the effect of compounds on peptide uptake

    • Growth inhibition studies: Testing compounds against wild-type and overexpression strains

    • Synergy testing: Evaluating combinations with existing anti-TB drugs

  • Potential considerations:

    • The efficacy of transport inhibitors may depend on the essentiality of transported substrates

    • Redundancy in transport systems might affect the effectiveness of single-target inhibitors

    • Combination approaches with other anti-TB drugs might be necessary for optimal efficacy

The development of inhibitors targeting Rv1282c could follow methodologies similar to those used for other M. tuberculosis proteins like Rv1250, where homology modeling, molecular docking, and dynamics simulation have been employed to identify potential drug binding sites .

How does Rv1282c expression change under different growth conditions and in response to antibiotics?

The expression pattern of Rv1282c under different growth conditions and in response to antibiotics provides insights into its physiological role and potential involvement in drug responses:

  • Environmental regulation:

    • Nutrient limitation: Expression may increase during peptide or amino acid limitation

    • Acidic pH: Changes in expression may occur in acidified environments resembling the phagolysosome

    • Hypoxia: Expression patterns may shift during oxygen limitation, a condition encountered during latent infection

  • Antibiotic response:

    • First-line TB drugs: Studies of related transport systems have examined changes in efflux pump gene expression in response to anti-tuberculosis drugs

    • Exposure duration: Acute versus chronic drug exposure may elicit different expression patterns

    • Drug combinations: Complex regulation may occur with multi-drug regimens

  • Research methodologies:

    • Quantitative RT-PCR: For measuring transcript levels under controlled conditions

    • RNA-Seq: For genome-wide expression analysis comparing Rv1282c with other genes

    • Reporter fusions: Using fluorescent or enzymatic reporters fused to the Rv1282c promoter

    • Proteomics: Confirming changes at the protein level through mass spectrometry

  • Correlation with phenotype:

    • Transport assays: Relating expression changes to functional transport activity

    • Susceptibility testing: Determining how expression changes affect antibiotic efficacy

    • Mutation frequency: Examining whether expression changes alter mutation rates or adaptability

Understanding these expression patterns can inform both basic biological understanding and therapeutic approaches, potentially revealing conditions where inhibition of Rv1282c would be most effective or identifying combinations with existing drugs that might prevent resistance development.

How can molecular dynamics simulations be applied to study Rv1282c structure and function?

Molecular dynamics (MD) simulations provide powerful tools for studying Rv1282c structure and function at the atomic level:

  • Simulation setup and protocols:

    • Force field selection: For membrane proteins like Rv1282c, specialized force fields like GROMOS96 43a1 are appropriate

    • System preparation: Embedding the protein in a lipid bilayer mimicking the mycobacterial membrane

    • Solvation: Using simple point charge (SPC) water models in an appropriately sized simulation box

    • Energy minimization: Removing steric clashes and unfavorable interactions

    • Equilibration: Running NVT (constant number, volume, temperature) and NPT (constant number, pressure, temperature) equilibration phases for at least 1 ns each

    • Production simulation: Extending to 100 ns or longer for comprehensive conformational sampling

  • Analysis approaches:

    • Stability assessment: Root-mean-square deviation (RMSD) analysis of protein backbone

    • Conformational changes: Principal component analysis to identify major motions

    • Binding site characterization: Identifying and characterizing substrate binding pockets

    • Hydrogen bond analysis: Quantifying hydrogen bond occupancy between protein residues and substrates

    • Channel dynamics: Analyzing pore diameter fluctuations and water/ion permeation

  • Advanced applications:

    • Substrate translocation: Simulating the complete transport cycle with bound peptides

    • Protein-protein interactions: Modeling interfaces with other ABC transporter components

    • Inhibitor binding: Virtual screening and binding free energy calculations for potential drugs

  • Integration with experimental data:

    • Using simulation predictions to guide mutagenesis experiments

    • Refining structural models based on experimental constraints

    • Explaining functional data through structural mechanisms

These approaches have been successfully applied to similar proteins like Rv1250, where MD simulations were used to evaluate model stability and analyze protein-ligand interactions over extended timescales .

What are the challenges in crystallizing membrane proteins like Rv1282c, and what alternative structural biology approaches can be used?

Crystallizing membrane proteins like Rv1282c presents numerous challenges, but several alternative structural biology approaches can circumvent these difficulties:

  • Challenges in crystallization:

    • Hydrophobicity: Membrane proteins require detergents or lipids for solubilization, which can interfere with crystal contacts

    • Conformational heterogeneity: Transport proteins often exist in multiple states, hindering crystal formation

    • Expression levels: Obtaining sufficient quantities of purified protein is often difficult

    • Stability: Maintaining native structure outside the membrane environment is challenging

  • Alternative structural approaches:

    a. Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structures without crystallization

    • Visualizing different conformational states in the transport cycle

    • Analyzing the complete ABC transporter complex

    b. Nuclear magnetic resonance (NMR) spectroscopy:

    • Solution NMR for smaller domains or fragments

    • Solid-state NMR for membrane-embedded full-length proteins

    • Dynamics studies providing information on conformational changes

    c. Computational methods:

    • Homology modeling using related structures as templates

    • Ab initio modeling for regions lacking homology

    • Molecular dynamics refinement of predicted structures

    • Evolutionary coupling analysis to identify interacting residues

  • Hybrid approaches:

    • Integrating low-resolution experimental data with computational models

    • Validating predicted structures through targeted biochemical experiments

    • Using crosslinking and mass spectrometry to provide distance constraints

  • Successful examples from related proteins:

    • Crystal structures of related bacterial ABC transporters

    • Cryo-EM structures of complete ABC transporter complexes

    • Computational models validated through functional studies

These alternative approaches can provide valuable structural insights even when crystallization proves challenging, as demonstrated by the successful application of computational methods to predict the structure of Rv1250 protein from M. tuberculosis .

How can systems biology approaches integrate Rv1282c function into the broader context of M. tuberculosis metabolism and pathogenesis?

Systems biology approaches can effectively integrate Rv1282c function into the broader context of M. tuberculosis metabolism and pathogenesis through multiple complementary strategies:

  • Multi-omics integration:

    • Transcriptomics: Correlating Rv1282c expression with global gene expression patterns

    • Proteomics: Identifying protein-protein interaction networks involving Rv1282c

    • Metabolomics: Measuring changes in peptide and amino acid pools in wild-type versus mutant strains

    • Lipidomics: Examining potential effects on cell wall composition and remodeling

  • Network analysis:

    • Regulatory networks: Identifying transcription factors controlling Rv1282c expression

    • Metabolic networks: Mapping peptide utilization pathways connected to Rv1282c function

    • Protein interaction networks: Placing Rv1282c in the context of membrane protein complexes

    • Signaling networks: Exploring potential signaling roles of imported peptides

  • Mathematical modeling:

    • Flux balance analysis: Incorporating peptide transport into genome-scale metabolic models

    • Ordinary differential equation models: Simulating dynamics of transporter activity

    • Agent-based models: Integrating transporter function into host-pathogen interaction models

  • Experimental validation strategies:

    • Perturbation studies: Creating defined genetic or chemical perturbations and measuring system-wide responses

    • Synthetic lethality screening: Identifying genes with functional relationships to Rv1282c

    • Conditional mutants: Using inducible systems to modulate Rv1282c expression and monitor global effects

  • Applications in drug discovery:

    • Target vulnerability assessment: Evaluating system-wide consequences of Rv1282c inhibition

    • Synergistic drug combinations: Identifying complementary targets based on network analysis

    • Resistance mechanisms: Predicting potential compensatory pathways

These approaches facilitate a comprehensive understanding of how Rv1282c contributes to the complex biology of M. tuberculosis beyond its immediate role in peptide transport, potentially revealing unexpected connections to virulence mechanisms, stress responses, and drug susceptibility.

What are common difficulties in working with recombinant Rv1282c and how can they be overcome?

Working with recombinant Rv1282c presents several technical challenges, but various strategies can help overcome these difficulties:

  • Protein expression challenges:

    • Low expression levels: Optimize codon usage for expression host; use strong inducible promoters; test multiple expression strains

    • Toxicity to host cells: Use tightly regulated expression systems; consider lower growth temperatures; employ specialized strains with enhanced membrane protein expression capabilities

    • Inclusion body formation: Reduce expression rate through lower inducer concentrations and temperatures; co-express molecular chaperones; use solubility-enhancing fusion tags

  • Protein extraction and purification issues:

    • Inefficient membrane extraction: Test a panel of detergents (DDM, LMNG, CHAPS) at various concentrations; optimize extraction time and temperature

    • Protein aggregation: Include stabilizing agents like glycerol or specific lipids; maintain strict temperature control during purification

    • Low purity: Implement multi-step purification strategies combining affinity chromatography with ion exchange and size exclusion methods

  • Functional assay limitations:

    • Lack of transport activity: Reconstitute into proteoliposomes with appropriate lipid composition; ensure proper orientation in membrane; include all necessary complex components

    • High background in transport assays: Optimize washing protocols; use competitive inhibitors to determine specific transport; develop robust negative controls

    • Substrate uncertainty: Screen diverse peptide libraries; use radiolabeled or fluorescently tagged peptides for direct monitoring

  • Structural instability:

    • Conformational heterogeneity: Stabilize specific conformations using inhibitors, nucleotide analogs, or conformation-specific nanobodies

    • Limited stability after purification: Optimize buffer conditions through thermal stability screening; add specific lipids or cholesterol analogs; use protein engineering to remove flexible regions

This systematic approach to troubleshooting can significantly improve success rates when working with challenging membrane proteins like Rv1282c.

How can I interpret contradictory results from different experimental approaches when studying Rv1282c?

Interpreting contradictory results from different experimental approaches when studying Rv1282c requires systematic analysis:

  • Methodological evaluation:

    • Assay sensitivity and specificity: Different methods have varying detection limits and potential interference sources

    • Experimental conditions: Variations in temperature, pH, ionic strength, or detergent composition can affect protein behavior

    • Temporal considerations: Acute versus chronic experiments may reveal different aspects of protein function

    • System complexity: In vitro reconstituted systems versus cellular contexts can yield different results

  • Resolution strategies:

    • Orthogonal validation: Implement additional, independent methods to break the tie between contradictory results

    • Titration experiments: Test across a range of conditions to determine if contradictions are condition-dependent

    • Control experiments: Include positive and negative controls to validate each experimental approach

    • Literature comparison: Evaluate how similar contradictions were resolved for related proteins

  • Reconciliation framework:

    • Consider if results reflect different conformational states or functional modes of the transporter

    • Evaluate if the protein functions differently in different lipid environments or cellular contexts

    • Assess if post-translational modifications or interaction partners might explain the discrepancies

    • Determine if measured parameters (e.g., binding versus transport) represent different steps in the transport cycle

  • Documentation and reporting:

    • Thoroughly document all experimental conditions and variables

    • Present contradictory results transparently in publications

    • Propose testable hypotheses that could explain the contradictions

    • Suggest specific follow-up experiments to resolve the discrepancies

This analytical approach transforms contradictory results from a research obstacle into an opportunity for deeper mechanistic insights into Rv1282c function.

What are the best practices for designing mutagenesis studies of Rv1282c to elucidate structure-function relationships?

Designing effective mutagenesis studies for Rv1282c requires strategic planning and implementation:

  • Target selection strategies:

    • Sequence conservation analysis: Focus on residues conserved across bacterial peptide transporters

    • Structural prediction: Use homology models to identify putative functional sites

    • Charged residues in transmembrane domains: These often play crucial roles in substrate recognition or translocation

    • Domain interfaces: Target residues at interfaces between domains or subunits

    • Motif-based selection: Focus on known functional motifs in ABC transporters

  • Mutation design principles:

    • Conservative substitutions: Ala scanning for initial functional mapping

    • Non-conservative substitutions: Charge reversals for electrostatic interactions; bulky side chains for steric effects

    • Cysteine substitutions: For accessibility studies and cross-linking experiments

    • Multiple mutations: Design double or triple mutants to test cooperativity or compensatory effects

  • Functional validation approaches:

    • Transport assays: Measure effects on peptide uptake kinetics and substrate specificity

    • ATPase activity: Determine how mutations affect coupling between ATP hydrolysis and transport

    • Growth phenotypes: Test complementation of knockout strains with mutant variants

    • Protein interaction studies: Assess effects on assembly with other transporter components

  • Structural validation:

    • Thermal stability assays: Determine if mutations affect protein stability

    • Limited proteolysis: Probe conformational changes induced by mutations

    • Molecular dynamics simulations: Model effects of mutations on protein dynamics

    • Disulfide cross-linking: Validate predicted proximity of specific residues

  • Interpretation framework:

    • Classify mutations into functional categories (binding, transport, coupling, etc.)

    • Create spatial maps of functional regions based on mutational effects

    • Correlate experimental results with computational predictions to refine structural models

    • Compare with mutagenesis data from related transporters to identify conserved mechanisms

This comprehensive approach to mutagenesis can systematically decode the structural basis for Rv1282c function and potentially identify sites for therapeutic targeting.

What are the most promising future research directions for understanding Rv1282c function in the context of tuberculosis treatment?

The most promising future research directions for understanding Rv1282c function in the context of tuberculosis treatment encompass several interconnected areas:

  • Structure-based drug design:

    • Obtaining high-resolution structural information through cryo-EM or crystallography

    • Using computational approaches like those applied to Rv1250 to identify druggable binding sites

    • Developing small molecule inhibitors that selectively target Rv1282c or the Opp system

    • Exploring allosteric inhibition mechanisms that disrupt transporter dynamics

  • Systems-level understanding:

    • Defining the comprehensive substrate profile of the transporter

    • Identifying conditions where Rv1282c becomes essential for M. tuberculosis survival

    • Mapping genetic interactions to uncover potential combination therapy targets

    • Integrating Rv1282c function into whole-cell models of M. tuberculosis metabolism

  • Host-pathogen interactions:

    • Investigating the role of Rv1282c in immune evasion strategies

    • Determining if the transporter contributes to survival within macrophages

    • Exploring potential interactions with host-derived antimicrobial peptides

    • Examining the importance of peptide transport during different infection stages

  • Translational approaches:

    • Testing identified inhibitors in cellular and animal models of tuberculosis

    • Developing high-throughput screening platforms specific for peptide transport inhibition

    • Creating diagnostic tools based on Rv1282c expression or activity patterns

    • Exploring combination therapies targeting Rv1282c alongside established drug targets

  • Novel technological applications:

    • Applying CRISPR interference to modulate Rv1282c expression in M. tuberculosis

    • Developing biosensors based on Rv1282c to detect infection or monitor drug efficacy

    • Using artificial intelligence to predict optimal inhibitor structures

    • Applying single-cell analysis to understand heterogeneity in transporter expression

These research directions hold significant promise for advancing both fundamental understanding of M. tuberculosis biology and development of novel therapeutic approaches targeting peptide transport systems.

How might advances in structural biology techniques impact our understanding of Rv1282c and related membrane transporters?

Advances in structural biology techniques are poised to revolutionize our understanding of Rv1282c and related membrane transporters through several transformative approaches:

  • Cryo-electron microscopy breakthroughs:

    • Single-particle analysis reaching near-atomic resolution for membrane proteins

    • Capture of multiple conformational states revealing the complete transport cycle

    • Visualization of native lipid interactions critical for transporter function

    • Structure determination in complex with substrate peptides and inhibitors

  • Integrated structural biology:

    • Hybrid methods combining data from multiple techniques (cryo-EM, NMR, X-ray crystallography)

    • Mass spectrometry-based structural analysis including hydrogen-deuterium exchange and crosslinking

    • Electron paramagnetic resonance spectroscopy to measure distances and conformational changes

    • Small-angle X-ray and neutron scattering for solution-state structural information

  • Dynamic structural techniques:

    • Time-resolved cryo-EM capturing transient conformational states

    • Advanced NMR methods for measuring dynamics across multiple timescales

    • High-speed atomic force microscopy for visualizing conformational changes in near-native conditions

    • Raman spectroscopy for probing site-specific changes during transport cycles

  • Computational advances:

    • AI-powered structural prediction through platforms like AlphaFold specifically optimized for membrane proteins

    • Enhanced molecular dynamics simulations accessing longer timescales and larger systems

    • Quantum mechanics/molecular mechanics approaches for modeling substrate recognition and translocation

    • Network-based analysis of allosteric communication pathways

  • Impact on understanding and applications:

    • Elucidation of substrate specificity determinants through structure-guided mutagenesis

    • Rational design of selective inhibitors targeting specific conformational states

    • Understanding of coupled mechanisms linking ATP hydrolysis to transport

    • Insights into evolution and specialization of peptide transporters across bacterial species

These advances will transform our currently limited structural understanding of Rv1282c into a comprehensive, dynamic view of its function, facilitating more effective targeting strategies for tuberculosis treatment.

What lessons can be learned from studying other bacterial peptide transporters that might apply to Rv1282c research?

Lessons from other bacterial peptide transporters provide valuable insights applicable to Rv1282c research:

  • Mechanistic principles from model systems:

    • Substrate recognition mechanisms from well-studied systems like DppA in E. coli

    • Conformational coupling between nucleotide binding and translocation from maltose transporters

    • Oligomeric assembly and stability determinants from various ABC transporters

    • Proton or sodium coupling mechanisms from secondary active transporters

  • Physiological roles beyond nutrition:

    • Involvement in cell wall recycling observed in several bacterial species

    • Roles in quorum sensing through internalization of signaling peptides

    • Contributions to antibiotic resistance through import of resistance-conferring peptides

    • Importance in adapting to environmental stresses demonstrated in multiple bacteria

  • Experimental approaches that have proven successful:

    • In vivo substrate trapping strategies that identify physiological substrates

    • Fluorescence-based transport assays enabling high-throughput screening

    • Nanobody development for stabilizing specific conformational states

    • Native mass spectrometry for analyzing intact complexes and bound substrates

  • Structure-function correlations:

    • Identification of conserved motifs critical for transport function

    • Understanding of how substrate-binding proteins deliver peptides to transmembrane domains

    • Insights into ATP binding and hydrolysis cycles coordinated with transport

    • Lipid requirements for optimal transporter function and stability

  • Translational applications:

    • Development of peptide mimetics as competitive inhibitors

    • Identification of narrow-spectrum antibiotics targeting specific transporters

    • Engineering of peptide transporters for drug delivery applications

    • Creation of attenuated vaccine strains through transporter modification

These lessons from diverse bacterial peptide transporters can accelerate Rv1282c research by providing testable hypotheses, validated methodologies, and conceptual frameworks for understanding this important M. tuberculosis component.

What are the most appropriate in vivo models for studying Rv1282c function in the context of tuberculosis infection?

Selecting appropriate in vivo models for studying Rv1282c function during tuberculosis infection requires careful consideration of several factors:

  • Mouse models:

    • C57BL/6 mice: Standard model for TB research with well-characterized immune responses

    • C3HeB/FeJ mice: Develop human-like granulomatous lesions with caseous necrosis

    • Humanized mice: Engrafted with human immune cells to better mimic human immune responses

    • Conditional knockout models: For studying host factors interacting with bacterial transporters

  • Other animal models:

    • Guinea pigs: Develop pathology closely resembling human tuberculosis

    • Non-human primates (macaques): Most physiologically relevant model with spectrum of disease outcomes

    • Zebrafish-M. marinum: Transparent model allowing real-time visualization of early infection events

    • Rabbits: Develop caseous lesions similar to human tuberculosis

  • Experimental design considerations:

    • Infection route: Aerosol exposure most closely mimics natural infection

    • Bacterial strain preparation: Log-phase versus stationary cultures affect initial responses

    • Bacterial burden monitoring: CFU enumeration, bioluminescence, or PET-CT imaging

    • Time course: Short-term versus long-term studies for acute versus chronic effects

  • Analytical approaches:

    • Comparative studies: Wild-type versus Rv1282c-mutant strains

    • Complementation analysis: Confirming phenotypes with restored Rv1282c expression

    • Tissue-specific analyses: Examining transporter importance in different infection sites

    • Transcriptomics: Monitoring Rv1282c expression throughout infection course

  • Specialized applications:

    • Drug efficacy testing: Evaluating Rv1282c inhibitors in infected animals

    • Vaccine evaluation: Testing attenuated strains with Rv1282c modifications

    • Host-directed therapies: Combining bacterial and host targets

    • Relapse models: Studying role in persistence and reactivation

When designing these studies, researchers should consider the ethical implications and apply the 3Rs principle (replacement, reduction, refinement) while ensuring sufficient statistical power to detect biologically meaningful effects.

How can transcriptomics and proteomics be effectively integrated to understand the role of Rv1282c in M. tuberculosis physiology?

Integrating transcriptomics and proteomics provides a comprehensive approach to understanding Rv1282c function in M. tuberculosis physiology:

  • Experimental design strategies:

    • Parallel sampling: Collecting matched samples for both analyses from identical conditions

    • Time-course studies: Capturing dynamic changes across multiple timepoints

    • Perturbation approaches: Comparing wild-type and Rv1282c mutant strains under diverse conditions

    • Stimulus-response experiments: Monitoring adaptation to environmental changes or stresses

  • Transcriptomic methodologies:

    • RNA-Seq: For genome-wide expression profiling with high sensitivity

    • Targeted RT-qPCR: For validating specific expression changes in Rv1282c and related genes

    • Single-cell transcriptomics: For capturing population heterogeneity in expression

    • Ribosome profiling: For measuring translation efficiency alongside transcript levels

  • Proteomic approaches:

    • Shotgun proteomics: For broad protein identification and relative quantification

    • Targeted proteomics (PRM/MRM): For precise quantification of Rv1282c and interacting proteins

    • Phosphoproteomics: For identifying regulatory post-translational modifications

    • Membrane-enriched proteomics: For focusing specifically on the membrane proteome containing Rv1282c

  • Integration methods:

    • Correlation analysis: Identifying concordance or discordance between transcript and protein levels

    • Pathway enrichment: Finding biological processes affected at both levels

    • Network analysis: Constructing integrated regulatory networks

    • Machine learning approaches: Predicting functional relationships from multi-omic patterns

  • Biological insights:

    • Regulatory mechanisms: Transcriptional versus post-transcriptional regulation of Rv1282c

    • Compensatory responses: Alternative transporters upregulated in Rv1282c mutants

    • Conditional essentiality: Conditions where Rv1282c becomes critical for survival

    • Co-expression patterns: Identifying functionally related genes and proteins

  • Validation strategies:

    • Genetic manipulation: Creating knockout or overexpression strains of co-regulated genes

    • Reporter assays: Confirming regulatory relationships using fluorescent or enzymatic reporters

    • Metabolomic analysis: Correlating expression changes with metabolite profiles

    • Phenotypic testing: Relating expression patterns to growth, survival, or virulence phenotypes

This integrated approach provides a systems-level understanding of how Rv1282c contributes to M. tuberculosis physiology across different conditions and perturbations.

What are the critical considerations for designing high-throughput screens to identify inhibitors of Rv1282c?

Designing effective high-throughput screens (HTS) for Rv1282c inhibitors requires careful consideration of multiple factors:

  • Assay format selection:

    • Transport assays: Using fluorescent or radiolabeled peptide substrates to directly measure uptake inhibition

    • Growth inhibition: Screening for compounds that selectively inhibit growth of wild-type versus Rv1282c-mutant strains

    • Binding assays: Measuring displacement of labeled ligands from purified Rv1282c or substrate-binding proteins

    • Reporter systems: Using engineered strains where Rv1282c inhibition triggers a fluorescent or luminescent signal

  • Technical optimization:

    • Miniaturization: Adapting assays to 384- or 1536-well format while maintaining sensitivity

    • Signal-to-background ratio: Ensuring robust differentiation between hits and non-hits (Z' factor >0.5)

    • DMSO tolerance: Validating assay performance at DMSO concentrations used for compound delivery

    • Automation compatibility: Designing protocols suitable for robotic liquid handling systems

  • Compound library considerations:

    • Diversity-oriented collections: For broad sampling of chemical space

    • Focused libraries: Targeting ABC transporters or bacterial membrane proteins

    • Natural product libraries: Leveraging scaffolds evolved to interact with biological systems

    • Fragment libraries: For identifying starting points for medicinal chemistry optimization

  • Counter-screening strategies:

    • Selectivity: Testing hits against human ABC transporters to identify selective inhibitors

    • Cytotoxicity: Assessing effects on mammalian cell viability

    • Membrane integrity: Excluding non-specific membrane disruptors

    • Mode of action validation: Confirming Rv1282c as the primary target

  • Hit validation cascade:

    • Dose-response relationships: Determining IC50 values for primary hits

    • Orthogonal assays: Confirming activity in mechanistically distinct secondary assays

    • Structure-activity relationship studies: Testing related analogs to establish structural requirements

    • Resistance selection: Attempting to generate resistant mutants to confirm target engagement

  • Collaboration considerations:

    • Academic-industry partnerships for access to diverse compound libraries

    • Integration with medicinal chemistry expertise for hit optimization

    • Coordination with structural biology teams to enable structure-based optimization

    • Planning for downstream preclinical development including pharmacokinetic studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.