Recombinant Putative peptide transport permease protein Rv1283c/MT1320 (Rv1283c, MT1320)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

Rv1283c (oppB) encodes a 325-amino acid transmembrane protein with a molecular weight of ~35 kDa . Key features include:

PropertyValue
Genomic Location1436140–1437117 (complement strand)
Operon MembershipPart of the oppABCD operon
Functional DomainsABC transmembrane type-1 domain
Subcellular LocalizationMulti-pass membrane protein

The protein forms a permease complex with OppC (Rv1282c), facilitating oligopeptide translocation across the cytoplasmic membrane via ATP hydrolysis .

Research Applications and Findings

Key studies utilizing recombinant OppB include:

  • Operon Characterization: Genetic interruption of oppD (ATPase subunit) in BCG confirmed the transporter’s energy dependence and substrate-binding role via OppA .

  • Structural Biology: Cryo-EM resolved OppABCD at 2.4–3.1 Å, revealing iron-sulfur clusters critical for conformational changes during peptide transport .

  • Drug Targeting: OppB’s membrane localization and essentiality in nutrient uptake make it a candidate for antitubercular drug development .

Interaction and Regulatory Networks

OppB co-regulates with genes in biclusters 0287 (residual 0.56) and 0388 (residual 0.53), with cis-regulatory motifs showing e-values of 0.00–4.30 . It physically interacts with:

  • OppC (Rv1282c): Permease partner

  • OppD (Rv1281c): ATP-binding component .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format preferences, please indicate them in your order remarks and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize development of the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Target Names
Rv1283c, MT1320
Target Protein Sequence
MTRYLARRLLNYLVLLALASFLTYCLTSLAFSPLESLMQRSPRPPQAVIDAKAHDLGLDR PILARYANWVSHAVRGDFGTTITGQPVGTELGRRIGVSLRLLVVGSVFGTVAGVVIGAWG AIRQYRLSDRVMTTLALLVLSTPTFVVANLLILGALRVNWAVGIQLFDYTGETSPGVAGG VWDRLGDRLQHLILPSLTLALAAAAGFSRYQRNAMLDVLGQDFIRTARAKGLTRRRALLK HGLRTALIPMATLFAYGVAGLVTGAVFVEKIFGWHGMGEWMVRGISTQDTNIVAAITVFS GAVVLLAGLLSDVIYAALDPRVRVS
Uniprot No.

Q&A

Structural Properties and Expression Systems

Q: What are the key structural characteristics of recombinant Rv1283c/MT1320?

Rv1283c/MT1320 is a full-length protein consisting of 325 amino acid residues that functions as a putative peptide transport permease . This membrane protein is typically expressed with a His-tag to facilitate purification while maintaining its functional integrity. The protein is commonly produced in E. coli expression systems, which provide adequate yields for research purposes while maintaining proper folding and functional activity . As a membrane-associated permease, the protein contains hydrophobic transmembrane domains that anchor it within the bacterial cell membrane, enabling it to form channels or pores for the selective transport of peptides across the membrane barrier.

When studying the structure of Rv1283c/MT1320, researchers should consider its integration into the lipid bilayer and potential interactions with other components of the peptide transport system. Similar to other bacterial permeases, it likely exhibits a multi-pass transmembrane configuration with specific regions dedicated to substrate recognition, binding, and translocation. Understanding these structural elements is critical for elucidating the protein's role in M. tuberculosis physiology and pathogenesis.

Functional Role in Mycobacterium tuberculosis

Q: How does Rv1283c/MT1320 contribute to M. tuberculosis survival and virulence?

Research has indicated that peptide transport systems in bacteria are linked to various cellular responses including sporulation, aerial hyphae formation, competence, and virulence . In M. tuberculosis, the Rv1283c/MT1320 permease system may contribute to the bacterium's ability to modulate its cell surface in response to environmental stimuli, a critical aspect of its pathogenicity. This modulation involves the participation of ion-linked and ATP-binding cassette transporters with oligopeptide-binding capabilities, forming an integral component of the bacterium's adaptive arsenal against host defense mechanisms.

Experimental Analysis and Mutagenesis Studies

Q: What mutagenesis approaches have been used to study the function of Rv1283c/MT1320?

Specialized transduction has been successfully employed to create functional null mutants through targeted mutagenesis of the Rv1283c-Rv1280c gene system . This technique involves deleting specific gene sequences while ensuring that essential adjacent genes remain intact and functional. For the Rv1283c-Rv1280c permease system, researchers developed a strategy that left the Rv1284 gene (which encodes a β-carbonic anhydrase essential for M. tuberculosis survival) and its associated promoter intact while deleting the target genes and marking them with a hygromycin resistance cassette .

The mutagenesis protocol typically involves amplifying fragments upstream from the annotated initiation codon, including the stop codon of adjacent genes, using specifically designed primers. For instance, when studying similar permease systems, researchers have used primers such as dppB#7 (5′-GGTACCATTAATGGCGCTGTCGGCCGCCATCAAC-3′) and dppB#8 (5′-TCTAGAGGCGACTCGGCGCGCAACATACCAG-3′) to amplify upstream regions . Transformants are then selected after extended growth periods (approximately 4 weeks at 37°C) on plates containing appropriate antibiotics like hygromycin and kanamycin to produce the desired mutant strains for functional studies.

Functional Analysis in Relation to Redox Regulation

Q: How might redox conditions affect the function of Rv1283c/MT1320 and related M. tuberculosis proteins?

While direct evidence for redox regulation of Rv1283c/MT1320 is limited, insights can be drawn from studies on other M. tuberculosis proteins such as Rv1284, a β-carbonic anhydrase essential for bacterial survival . Research has demonstrated that the catalytic activity of Rv1284 can be reversibly inhibited under oxidative conditions through a mechanism involving disulfide bond formation between cysteine residues in the active site . This oxidative modification leads to the removal of one of the active site cysteine residues from the coordination sphere of the catalytic metal ion, resulting in loss of the metal ion and subsequent catalytic inactivity.

Similar regulatory mechanisms may potentially affect Rv1283c/MT1320 and other membrane proteins in M. tuberculosis, particularly if they contain redox-sensitive cysteine residues. This redox sensitivity could represent an important adaptation mechanism linking oxidative stress to membrane transport functions and pH homeostasis of the pathogen. Since oxidative stress and acidification are defense mechanisms employed by the host's innate immune system, proteins like Rv1283c/MT1320 may be components of the mycobacterial survival strategy, adjusting their transport functions in response to the host environment.

Expression and Purification Protocols

Q: What are the optimal conditions for expressing and purifying recombinant Rv1283c/MT1320?

The expression of recombinant Rv1283c/MT1320 is typically achieved using E. coli as a host system, which provides a balance between yield and proper protein folding . For optimal expression, researchers should consider using a vector system that allows tight control of protein expression, such as those with IPTG-inducible promoters. The protein is commonly expressed with a His-tag to facilitate purification via immobilized metal affinity chromatography (IMAC) . Expression conditions typically involve induction at mid-log phase (OD600 of 0.6-0.8) and growth at lower temperatures (16-25°C) to enhance proper folding of the membrane protein.

Purification of Rv1283c/MT1320 requires careful handling due to its membrane-associated nature. After cell lysis, the membrane fraction is typically solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) that maintain protein stability and function. Purification via IMAC is followed by size exclusion chromatography to obtain homogeneous protein preparations. Throughout the purification process, it is crucial to maintain the protein in a detergent-containing buffer to prevent aggregation. Quality control measures should include SDS-PAGE, Western blotting, and activity assays to confirm the identity, purity, and functionality of the purified protein.

Functional Assays and Interaction Studies

Q: What techniques are most effective for studying the transport activity and protein interactions of Rv1283c/MT1320?

Several complementary approaches can be employed to assess the transport activity of Rv1283c/MT1320. Reconstitution of the purified protein into liposomes loaded with fluorescent peptide substrates allows for direct measurement of transport activity through changes in fluorescence intensity. Alternatively, radioactively labeled peptides can be used to quantify transport rates in both reconstituted systems and whole cells. For cell-based assays, researchers often use gene deletion mutants complemented with wild-type or mutated versions of the protein to assess functional consequences in vivo.

To study protein-protein interactions involving Rv1283c/MT1320, techniques such as co-immunoprecipitation, bacterial two-hybrid systems, and cross-linking studies can be employed. More advanced methods include surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC) for quantitative analysis of binding kinetics and thermodynamics. For structural studies of the protein and its complexes, approaches such as X-ray crystallography (if the protein can be crystallized) or cryo-electron microscopy may be suitable. Additionally, computational methods like molecular dynamics simulations can provide insights into the protein's conformational dynamics and substrate interactions.

Relationship to Other Bacterial Permeases

Q: How does Rv1283c/MT1320 compare to other peptide transport systems in mycobacteria and related bacteria?

Rv1283c/MT1320 belongs to a family of peptide transport permeases that are widely distributed across bacterial species . In M. tuberculosis, multiple permease systems exist, including the Rv3665c-3663c gene system, which has been studied alongside Rv1283c-Rv1280c . These systems likely have complementary or partially redundant functions in peptide transport, potentially providing the bacterium with metabolic flexibility and adaptability to different nutritional environments.

Comparative genomic analysis reveals that peptide transport systems in bacteria often consist of multiple components, including substrate-binding proteins, transmembrane permeases, and ATP-binding proteins that provide energy for active transport. While some permease systems primarily serve nutritional functions by importing peptides for metabolic use, others are involved in signaling processes that regulate bacterial responses to environmental conditions. Rv1283c/MT1320 may function within a larger complex of proteins that collectively determine substrate specificity, transport efficiency, and regulatory control. Understanding the similarities and differences between Rv1283c/MT1320 and other bacterial permeases can provide valuable insights into its specific role in M. tuberculosis physiology and pathogenesis.

Integration with Cellular Signaling Networks

Q: How might Rv1283c/MT1320 interface with cellular signaling pathways in M. tuberculosis?

Peptide transport systems in bacteria often interface with signaling networks that regulate various cellular processes . While specific information about Rv1283c/MT1320's role in signaling is limited, insights can be drawn from studies on related systems. In many bacteria, peptide transporters facilitate the uptake of signaling peptides that trigger specific cellular responses, including adaptation to stress conditions, regulation of virulence factors, and modulation of growth patterns.

Drawing parallels with other signaling systems such as the Myotubularin Related Proteins (MTMRs) studied in other contexts, we can hypothesize potential mechanisms by which Rv1283c/MT1320 might participate in cellular signaling . MTMRs, for example, interface with multiple signaling pathways through specific interaction motifs and domains. Similarly, Rv1283c/MT1320 might contain structural elements that enable it to interact with signaling proteins, potentially recruiting them to the membrane or modulating their activity in response to peptide transport events. These interactions could link the nutritional status of the bacterium, as sensed through peptide availability, to adaptive responses that enhance survival under challenging conditions such as those encountered within host macrophages.

Targeting Rv1283c/MT1320 for Therapeutic Intervention

Q: What strategies can be employed to target Rv1283c/MT1320 for tuberculosis drug development?

Given the potential importance of Rv1283c/MT1320 in M. tuberculosis survival and pathogenesis, it represents a promising target for therapeutic intervention. Drug development strategies could focus on disrupting the protein's transport function through competitive inhibitors that occupy the substrate-binding site or allosteric modulators that prevent conformational changes necessary for transport. The design of such inhibitors would benefit from detailed structural information about the protein, which could be obtained through techniques like X-ray crystallography or cryo-electron microscopy.

High-throughput screening approaches using fluorescence-based transport assays could identify potential inhibitors from chemical libraries. Computational methods, including virtual screening and molecular docking, can facilitate the identification of compounds likely to bind to specific sites on the protein. Once candidate inhibitors are identified, their specificity, efficacy, and toxicity would need to be evaluated through a combination of in vitro and in vivo studies. Given the need for new antibiotics against drug-resistant tuberculosis, the development of inhibitors targeting essential membrane transport systems like Rv1283c/MT1320 could contribute to expanding the therapeutic arsenal against this persistent pathogen.

Technical Challenges in Rv1283c/MT1320 Research

Q: What are the major technical hurdles in studying Rv1283c/MT1320, and how can they be addressed?

Research on Rv1283c/MT1320 faces several technical challenges common to membrane protein studies. First, expressing and purifying sufficient quantities of properly folded protein can be difficult due to the hydrophobic nature of membrane proteins. This challenge can be addressed by optimizing expression conditions, including host strain selection, growth temperature, and induction parameters, as well as exploring alternative expression systems such as yeast or insect cells that may better accommodate membrane proteins.

Second, maintaining protein stability and function during purification and subsequent experimental procedures requires careful selection of detergents and buffer conditions. Systematic screening of different detergents and lipid environments can identify optimal conditions for protein stability. Third, developing robust functional assays for peptide transport can be challenging, particularly if the natural substrates of Rv1283c/MT1320 are unknown. Approaches involving the use of substrate libraries and comparative analysis with related transporters of known specificity may help overcome this limitation. Addressing these technical challenges will be essential for advancing our understanding of Rv1283c/MT1320's role in M. tuberculosis physiology and its potential as a therapeutic target.

Future Research Priorities

Q: What are the most important unanswered questions about Rv1283c/MT1320 that should guide future research?

Future research on Rv1283c/MT1320 should prioritize several key questions. First, determining the precise substrate specificity of the transporter would provide valuable insights into its physiological role. This could be approached through a combination of in vitro transport assays with diverse peptide substrates and in vivo studies examining the growth phenotypes of deletion mutants on different peptide sources. Second, elucidating the three-dimensional structure of the protein would significantly advance our understanding of its transport mechanism and facilitate structure-based drug design efforts.

Additionally, investigating the regulation of Rv1283c/MT1320 expression and activity under different environmental conditions, particularly those relevant to infection, would enhance our understanding of its role in bacterial adaptation to the host environment. Studies examining potential interactions between Rv1283c/MT1320 and other proteins involved in cell wall maintenance, stress response, or virulence could reveal broader functional networks in which this permease participates. As research on M. tuberculosis continues to advance, integrating studies on Rv1283c/MT1320 with broader systems biology approaches will likely yield the most comprehensive understanding of this protein's contribution to tuberculosis pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.