Recombinant Putative peroxisome assembly protein 12 (prx-12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
prx-12; F08B12.2; Putative peroxisome assembly protein 12; Peroxin-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
prx-12
Target Protein Sequence
MSTTIRASQLASSISPKTEEKQPSVFDIIAQENLATSIRPALQHLVKYLAFFKPKTFLSV HRNFDEYYIIFDLILQNHYLRNYGASFTENFYSMKRIASGTGNPPNDGRERIMSLITLVG WPYVENKLNQLYDRLKEVYECRSWSSINGMKAKCQKMFVIIWPYIKTALKAVKSALQLAY ILNRSSIHSPWLYFSGVILKHLTPEDLEAFNAVPLHLQTGYQISRGTLNEHIHLRFFNRI WRFILGLPGIVSRLFAYGLFFVQFLDYMYNTDLAKLTKTGLDGAIPSPPHKMIISESEIL SLDTNKCPICLKKRVNDTALFVSGYVFCYTCINQYVNTYNKCPVTGCPANVQHLIRLFV
Uniprot No.

Target Background

Function
Essential for protein import into peroxisomes.
Database Links
Protein Families
Pex2/pex10/pex12 family
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.

Q&A

What is the fundamental structure and function of Peroxisome Assembly Protein 12?

Peroxisome Assembly Protein 12 (PEX12/PRX-12) is an integral peroxisomal membrane protein characterized by a zinc ring domain at its carboxy terminus. The protein spans the peroxisome membrane twice, with both its NH2 and COOH termini extending into the cytoplasm. PEX12 plays a critical role in peroxisomal matrix protein import, acting downstream of receptor docking events. The zinc-binding domain is particularly crucial for PEX12 function, as it mediates important protein-protein interactions necessary for peroxisomal biogenesis .

Methodological approach: To study the basic structure of PEX12, researchers typically employ techniques such as hydropathy plot analysis, transmembrane prediction algorithms, and epitope tagging experiments. For functional studies, complementation assays in PEX12-deficient cell lines represent the gold standard approach, allowing researchers to assess the ability of recombinant PEX12 constructs to restore peroxisomal matrix protein import.

How does PRX-12 interact with other peroxins in the peroxisomal import machinery?

PRX-12 interacts with at least two key peroxins through its zinc-binding domain: PEX5 (the PTS1 receptor) and PEX10 (another integral peroxisomal membrane protein). These interactions have been demonstrated through multiple complementary approaches, including yeast two-hybrid studies, blot overlay assays, and coimmunoprecipitation experiments. The zinc-binding domain of PRX-12 binds directly to PEX5, suggesting a role in PTS1 protein import. Similarly, PRX-12 interacts with the zinc ring domain of PEX10 (amino acids 240-326 of PEX10 and 260-359 of PRX-12), forming a complex that is maintained in vivo .

Methodological approach: To investigate protein-protein interactions involving PRX-12, researchers can use:

  • Yeast two-hybrid assays with the zinc-binding domain as bait

  • Recombinant fusion proteins (e.g., MBP-PRX-12) for in vitro binding assays

  • Coimmunoprecipitation with epitope-tagged proteins in mammalian cells

  • FRET or BiFC for visualizing interactions in live cells

What are the typical expression systems used for producing recombinant PRX-12?

While the search results don't specifically detail expression systems for recombinant PRX-12, based on established methodologies for membrane proteins, several systems can be considered:

Methodological approach: For recombinant PRX-12 production, researchers should consider:

  • Bacterial expression systems (E. coli) for truncated soluble domains like the zinc-binding region

  • Yeast expression (P. pastoris, S. cerevisiae) for full-length protein with proper folding

  • Insect cell expression systems (using baculovirus) for mammalian PRX-12 with post-translational modifications

  • Mammalian cell expression for studies requiring native conformation and modification patterns

Each system offers different advantages in terms of protein yield, folding accuracy, and post-translational modifications. For functional studies, expression in peroxisome-deficient cell lines allows complementation analysis to verify activity.

How do mutations in the zinc-binding domain of PRX-12 affect its interactions with other peroxins?

Mutations in the zinc-binding domain of PRX-12 can significantly impair its function and interactions. A specific missense mutation (S320F) identified in a patient with peroxisomal biogenesis disorder demonstrates how alterations in this domain can reduce binding to both PEX5 and PEX10. This mutation provides valuable insight into structure-function relationships within PRX-12. Interestingly, the functional deficit caused by this mutation can be suppressed through overexpression of either PEX5 or PEX10, suggesting that increased availability of these binding partners can compensate for reduced binding affinity .

Methodological approach: Researchers investigating PRX-12 mutations should:

  • Generate site-directed mutations in the zinc-binding domain

  • Assess binding affinity to PEX5 and PEX10 using quantitative pull-down assays

  • Perform complementation studies in patient-derived fibroblasts

  • Consider suppressor screens to identify functional relationships

  • Use structural modeling to predict the impact of mutations on the zinc-binding domain

What is the optimal experimental design for studying PRX-12 function in disease models?

When designing experiments to study PRX-12 function in disease models, researchers must carefully consider both statistical power and biological variability.

Methodological approach: For robust experimental design:

  • Use multiple cell lines or animal models to account for genetic background effects

  • Include sufficient biological replicates to achieve statistical power

  • Consider the use of patient-derived cells harboring PRX-12 mutations

  • Employ rescue experiments with wild-type and mutant PRX-12 constructs

  • Design appropriate controls for each experimental condition

Based on experimental design principles from similar studies, increasing the number of independent biological samples (different cell lines or animal models) provides more precise and reproducible estimates of effect size compared to increasing technical replicates within a single model. This approach better accounts for inter-sample variability, which is particularly important when studying the effects of PRX-12 mutations that may manifest differently depending on genetic background .

How can researchers distinguish between direct and indirect effects of PRX-12 dysfunction on peroxisomal matrix protein import?

Distinguishing direct from indirect effects of PRX-12 dysfunction represents a significant challenge in peroxisome research.

Methodological approach: To address this challenge, researchers should employ:

  • Temporal analysis using inducible expression or degradation systems

  • Structure-function studies with domain-specific mutations

  • Biochemical reconstitution of import steps in vitro

  • Proximity labeling approaches (BioID, APEX) to identify direct interaction partners

  • High-resolution imaging to track import intermediates

A key insight from existing research is that while PEX5 is predominantly cytoplasmic and previous PEX5-binding proteins were implicated in docking PEX5 to the peroxisome surface, loss of PRX-12 or PEX10 does not reduce PEX5 association with peroxisomes. This finding demonstrates that these peroxins are not required for receptor docking but instead function downstream in the import pathway .

What are the most effective approaches for studying the zinc-binding domain of PRX-12?

The zinc-binding domain of PRX-12 is critical for its function in peroxisomal matrix protein import.

Methodological approach: For studying this domain, researchers should consider:

  • Metal chelation assays to confirm zinc binding

  • Circular dichroism spectroscopy to analyze secondary structure

  • NMR or X-ray crystallography for detailed structural information

  • Mutagenesis of coordinating cysteine residues to disrupt zinc binding

  • Protein-protein interaction assays with and without zinc chelators

Phenotype-genotype correlations from patient studies provide valuable insights, as severe defects in PRX-12 activity are associated with mutations that truncate the protein upstream of the zinc ring domain, while moderately and mildly affected patients express at least one PRX-12 allele capable of encoding a protein containing the COOH-terminal zinc ring domain .

What statistical approaches are recommended for PRX-12 functional studies?

When designing experiments to assess PRX-12 function, statistical considerations are crucial for generating reliable and reproducible results.

Methodological approach: For robust statistical analysis:

  • Determine appropriate sample sizes through power analysis

  • Consider both ANOVA and Cox regression for survival or functional endpoints

  • Account for biological variability by including multiple cell lines or models

  • Use mixed-effects models when working with nested experimental designs

  • Report effect sizes along with p-values for better interpretation

Based on analogous experimental design principles, to achieve 80% statistical power using ANOVA when measuring functional differences, experiments should either use multiple biological replicates (models/cell lines) with fewer technical replicates per condition, or if using a single model, include significantly more technical replicates. For example, experiments using 10 different biological models might achieve sufficient power with just 1-2 technical replicates per model per condition, while experiments with a single model might require 6-9 technical replicates per condition .

How should researchers approach the production and purification of recombinant PRX-12 for structural studies?

Obtaining sufficient quantities of properly folded recombinant PRX-12 for structural studies presents significant challenges due to its membrane-spanning domains.

Methodological approach: For successful production and purification:

  • Express the cytoplasmic domains (especially the zinc-binding domain) separately for initial structural characterization

  • Use fusion tags (MBP, GST) to enhance solubility

  • Consider nanodiscs or amphipols for stabilizing full-length protein

  • Optimize detergent conditions through small-scale screening

  • Employ quality control measures (size exclusion chromatography, dynamic light scattering) to assess homogeneity

  • Validate protein folding through functional binding assays

For the zinc-binding domain specifically, expression as a maltose-binding protein fusion (MBP-PRX-12) has proven successful in maintaining proper folding and functionality for binding studies .

How do PRX-12 mutations contribute to peroxisomal biogenesis disorders?

Mutations in human PRX-12 (PEX12) result in peroxisomal biogenesis disorders, most notably Zellweger syndrome, a lethal neurological disorder. The severity of the clinical phenotype correlates with the nature of the mutations, particularly regarding their impact on the zinc ring domain.

Methodological approach: For investigating pathogenic mechanisms:

  • Catalog and characterize patient mutations using genomic sequencing

  • Perform complementation studies in patient-derived fibroblasts

  • Develop cellular and animal models with patient-specific mutations

  • Assess peroxisomal matrix protein import efficiency quantitatively

  • Examine downstream metabolic consequences of import deficiency

Genotype-phenotype correlation analysis reveals that severe defects in PRX-12 activity are associated with mutations that truncate the protein upstream of the zinc ring domain, while less severe phenotypes are observed in patients expressing at least one PRX-12 allele capable of encoding a protein containing the COOH-terminal zinc ring domain .

What therapeutic approaches might address PRX-12 dysfunction in peroxisomal disorders?

While the search results don't directly address therapeutic approaches for PRX-12 dysfunction, conceptual approaches can be derived from the mechanisms of action.

Methodological approach: Potential therapeutic strategies include:

  • Gene therapy to introduce functional PRX-12

  • Pharmacological chaperones to stabilize mutant PRX-12 with folding defects

  • Overexpression of interacting partners (PEX5, PEX10) to compensate for reduced binding affinity

  • Small molecule screening to identify compounds that enhance residual PRX-12 function

  • Metabolic bypass strategies to address downstream consequences of peroxisomal deficiency

The observation that overexpression of either PEX5 or PEX10 can suppress certain PRX-12 mutations provides a potential therapeutic avenue, suggesting that enhancing these interactions might compensate for some PRX-12 defects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.