Recombinant Putative phosphatidylcholine:ceramide cholinephosphotransferase 1 (sms-1)
Shipped with Ice Packs 
In Stock 
Description
Biochemical Properties of SMS1
Enzymatic Activities:
SMS1 also exhibits weak phosphatidylethanolamine (PE)-PLC activity, though 300-fold lower than its SM synthase activity .
Functional Roles in Cellular Processes
-
Sphingolipid Homeostasis: SMS1 counteracts ceramide accumulation by converting it to SM, thereby regulating apoptosis and cell proliferation .
-
Oncogenic Signaling: In chronic myelogenous leukemia (CML), Bcr-Abl upregulates SMS1 transcription 30-fold and shifts its transcription start site (TSS), enhancing translational efficiency by 20-fold. This drives SM synthesis and leukemic cell survival .
-
Protein Trafficking: SMS1-derived DAG recruits protein kinase D (PKD) to the Golgi, facilitating TGN-to-plasma membrane vesicle fission. SMS1 knockdown disrupts insulin secretion in pancreatic β-cells .
Mechanistic Insights
-
Catalytic Mechanism: SMS1 operates via a two-step process:
-
Membrane Topology: The catalytic site faces the Golgi lumen, ensuring SM synthesis occurs in the exoplasmic leaflet .
Research Findings
-
Disease Relevance:
-
Pharmacological Targeting:
Comparative Analysis of SMS Isoforms
| Feature | SMS1 | SMS2 |
|---|---|---|
| Localization | Golgi apparatus | Golgi and plasma membrane |
| Primary Activity | SM synthesis | SM synthesis + PE→CPE conversion |
| PC-PLC Activity | Moderate (Km = 62.3 µM) | High (Km = 48.9 µM) |
| Role in Trafficking | Critical for PKD recruitment | Minor role |
Applications of Recombinant SMS1
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
sms-1; H21P03.3; Phosphatidylcholine:ceramide cholinephosphotransferase 1; PC:ceramide cholinephosphotransferase 1; Sphingomyelin synthase 1; CSS3alpha1; SMS-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-469
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sms-1
Target Protein Sequence
MSVTVEVADEETHDVPLVEQVRTTPDQNVDVKVQENNVVTTKIGPKLETIPAAKMQDDNG
DEEKAENSEGAAAEKVEKQHDDDGVVVHEETDGVASSRSSHHDKQKPGETKKSGDGKMDD
DDIITTARSSSRRICGSAASSSDSETADDAPLLPDEGPSHAVRLEMPGDKPASPHDRFPK
TPLKTLVAFLMLVVAAAGNTITLSWIHERYPLTPPLPDIVFELIPKIPWGLRLCENLMIG
SFVSLLVLILFHRHRWIVLRRLCFIGSILYGMRCITMMVTPVPKADEDFECSPRFGENAT
FSLIVMRGVWSMFGLGLNLFDNQKVVLCGDYIYSGHTLVLVVSALFIGEYSPRRFYILHW
LSWLVCSVGVIFLVLSHGHYTIDVILSYFACTRVFWAYHTQAAHPSIRLSVQNHQAKEFW
FPLLRWFEGDIRRPVPRRFDCPISYSQVCNAFRRVRPRGRNGAARPAFE
Uniprot No.
Target Background
Function
Sphingomyelin synthases (SM synthase or SMS) catalyze the synthesis of the sphingolipid sphingomyelin (SM) by transferring the phosphatidyl head group of 1,2-diacyl-sn-glycero-3-phosphocholine (phosphatidylcholine, PC) to the primary hydroxyl of ceramide (N-acylsphingoid base), yielding 1,2-diacyl-sn-glycerol (diacylglycerol, DAG) as a byproduct. These enzymes function as bidirectional lipid cholinephosphotransferases, capable of converting PC and ceramide to SM and DAG, and vice versa, depending on the respective levels of ceramide and DAG as phosphocholine acceptors.
Database Links
Protein Families
Sphingomyelin synthase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
