Recombinant Putative potassium-transporting ATPase B chain (kdpB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant kdpB

The recombinant putative potassium-transporting ATPase B chain (kdpB) is a prokaryotic P-type ATPase expressed heterologously in E. coli for biochemical and structural studies. As the catalytic subunit of the KdpFABC complex, kdpB couples ATP hydrolysis to active potassium transport, enabling bacterial survival under potassium-limiting conditions . Recombinant kdpB is purified with affinity tags (e.g., His-tag) and retains functional properties critical for ion transport and ATPase activity .

Mechanism of ATPase Activity and Ion Transport

kdpB operates via a P-type ATPase mechanism, involving sequential phosphorylation and dephosphorylation :

  1. ATP Hydrolysis: ATP binds to the N domain, inducing phosphorylation of Asp583 (E1~P state) .

  2. Conformational Shift: Transition to E2-P state triggers movement of TM helices (M4–M6), opening a cytoplasmic pathway .

  3. K⁺ Translocation: K⁺ ions traverse an intersubunit tunnel from KdpA to kdpB, facilitated by residues like Phe232 in the constriction region .

  4. Release to Cytoplasm: K⁺ exits via a water-filled pathway in the E2-P state, driven by dephosphorylation .

Production and Biochemical Properties

Recombinant kdpB is expressed in E. coli with the following specifications :

ParameterDetails
Expression hostEscherichia coli
TagN-terminal His-tag
Protein lengthFull-length (682–709 amino acids)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in deionized water, with 50% glycerol for long-term storage

Phosphorylation-Dependent Regulation

  • Inhibitory phosphorylation: Ser162 phosphorylation in E. coli kdpB reduces ATPase activity under high K⁺ conditions .

  • Dephosphorylation: Alkaline phosphatase treatment restores ATPase activity, confirming regulatory roles of post-translational modifications .

Ion Transport Dynamics

  • Intersubunit tunnel: A 40-Å tunnel connects KdpA’s selectivity filter to kdpB’s binding sites, enabling K⁺ transfer .

  • Selectivity: Phe232 in kdpB acts as a gate, restricting Na⁺ passage while permitting K⁺ .

Functional Domains

  • Cytoplasmic domains: The H4H5 loop (residues 307–682) retains ATP hydrolysis and pNPPase activity, critical for catalytic cycling .

  • Mutational analysis: D307A mutation abolishes phosphorylation, while Lys586 stabilizes K⁺ coordination during transport .

Applications in Research

  • Structural studies: Cryo-EM structures of recombinant kdpB have resolved conformational states (E1·ATP, E1-P, E2-P) .

  • Drug targeting: kdpB’s role in bacterial osmoregulation makes it a candidate for antimicrobial development .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
kdpB; STY0746; t2170; Putative potassium-transporting ATPase ATP-binding subunit; ATP phosphohydrolase [potassium-transporting] B chain; Potassium-binding and translocating subunit B; Potassium-translocating ATPase B chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-569
Protein Length
full length protein
Species
Salmonella typhi
Target Names
kdpB
Target Protein Sequence
MSRKQLALFEPVLLVQALTDAVKKLSPRAQWRNPVMFVVWAGSVLATLLTLAMVTGQIAG SALFTGVISLWLWFTVLFANFAEALAEGRSKAQANSLKGVKKTAFARRLRAPRHDAQADN VPAAELRKGDIVLVKAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGGDFASVTGGR AVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDERTLADAAQLASLADETPEGRSIV ILAKQRFNLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVDAIRRHVESNGGHFP ADVEQNVENVARLGATPLVVVEGARVLGVIALKDIVKGGIKERFAQLRKMGIKTVMITGD NRLTAAAIAAEAGVDDFLAEATPEAKLALIRQYQAEGRLVAMTGDGTNDAPALAQADVAV AMNSGTQAAKEAGNMVDLDSNPTKLIEVVHIGKQMLMTRGSLTTFSIANDVAKYFAIIPA AFAATYPQLNALNVMGLHSPNSAILSAVIFNALIIIFLIPLALKGVSYKPLSASAMLRRN LWIYGLGGLVVPFIGIKVIDVLLTLLDLA
Uniprot No.

Target Background

Function
As a component of the high-affinity ATP-driven potassium transport (or Kdp) system, this subunit catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium into the cytoplasm. This subunit is responsible for energy coupling within the transport system.
Database Links

KEGG: stt:t2170

STRING: 220341.STY0746

Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IA subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of KdpB in the KdpFABC complex?

KdpB functions as the ATP-hydrolyzing subunit of the KdpFABC complex, which is responsible for high-affinity potassium uptake in bacteria and archaea. The complex is classified as a type IA P-type ATPase based on KdpB's biochemical properties . The KdpFABC complex represents an interesting chimera of ion pumps and ion channels, with KdpB providing the ATP hydrolysis functionality while KdpA resembles a potassium channel .

KdpB catalyzes the hydrolysis of ATP coupled with the exchange of hydrogen and potassium ions, enabling the transport of potassium against its concentration gradient . The catalytic reaction can be summarized as:

ATP + H₂O + K⁺(Out) = ADP + phosphate + K⁺(In)

KdpB contains multiple transmembrane domains and is classified as a multi-pass membrane protein localized to the cell inner membrane. It belongs to the cation transport ATPase (P-type) family (TC 3.A.3), specifically the Type IA subfamily .

How does the KdpB subunit interact with other components of the KdpFABC complex?

KdpB interacts with multiple components of the KdpFABC complex, particularly with KdpC which acts as a catalytic chaperone. Research has demonstrated that KdpC interacts with the nucleotide-binding loop of KdpB in an ATP-dependent manner around the ATP-binding pocket . This interaction increases the ATP-binding affinity through the formation of a transient KdpB/KdpC/ATP ternary complex .

The interaction between KdpB and KdpC involves a conserved glutamine residue in KdpC, which is critical for high-affinity nucleotide binding to the KdpFABC complex . This mechanism is unique and is not found in typical P-type ATPases or ion channels, although parallels exist in ABC transporters where ATP is coordinated by the LSGGQ signature motif via double hydrogen bonds at a conserved glutamine residue .

What experimental approaches are recommended for studying KdpB expression?

When expressing recombinant KdpB, researchers should consider several key factors:

  • Expression system selection: E. coli is commonly used for recombinant KdpB expression due to its native expression in this organism .

  • Construct design: Include appropriate tags (e.g., His-tag) for purification while ensuring tags don't interfere with protein function.

  • Membrane protein considerations: As KdpB is a multi-pass membrane protein, expression protocols should be optimized for membrane proteins, including considerations for detergent selection for solubilization.

  • Co-expression strategy: Consider co-expressing KdpB with other KdpFABC components, especially KdpC, which has been shown to interact with KdpB and enhance its stability and function .

The expression and purification protocol can be monitored through SDS-PAGE and Western blotting, with functional validation through ATPase activity assays.

How does the ATP-binding mechanism of KdpB differ from other P-type ATPases?

The ATP-binding mechanism of KdpB represents a unique variation compared to classical P-type ATPases, primarily due to the involvement of the KdpC subunit as a catalytic chaperone . In the KdpFABC complex, high-affinity nucleotide binding involves both the canonical ATP-binding domain of KdpB and the KdpC subunit .

Research has demonstrated that:

  • KdpC contains a conserved glutamine residue essential for high-affinity nucleotide binding to the complex, similar to the LSGGQ signature motif in ABC transporters .

  • Both ATP binding to KdpC and ATP hydrolysis activity of KdpFABC are sensitive to the accessibility, presence, or absence of hydroxyl groups at the ribose moiety of the nucleotide .

  • The KdpC subunit interacts with KdpB's nucleotide-binding loop in an ATP-dependent manner, forming a transient KdpB/KdpC/ATP ternary complex that increases ATP-binding affinity .

This mechanism differs significantly from other P-type ATPases where nucleotide binding typically involves only the P-type ATPase subunit without requiring additional chaperone subunits.

What experimental designs are most appropriate for studying KdpB function in vitro?

To study KdpB function in vitro, researchers should implement carefully controlled experimental designs that isolate specific aspects of protein function. A systematic approach includes:

  • Between-subjects experimental design: Compare different mutant versions of KdpB (independent variable) and measure ATP hydrolysis rates or potassium transport (dependent variable) . This design allows for direct comparison of functional differences without carry-over effects.

Table 1: Example of Between-Subjects Design for KdpB Mutant Analysis

KdpB VariantATP Hydrolysis Rate (nmol/min/mg)K⁺ Transport Rate (nmol/min/mg)n
Wild-type120.5 ± 8.285.3 ± 5.15
Mutation A98.7 ± 7.372.1 ± 4.85
Mutation B58.2 ± 6.931.8 ± 3.95
Mutation C10.3 ± 2.15.2 ± 1.75
  • Factorial experimental design: Examine how multiple factors (e.g., pH, temperature, ion concentrations) simultaneously affect KdpB function . This approach is valuable for understanding how environmental factors interact to influence protein activity.

  • Time-course experiments: Monitor conformational changes and ATP hydrolysis rates over time to capture the dynamic nature of the KdpB catalytic cycle.

When designing these experiments, control for extraneous variables such as buffer composition, temperature fluctuations, and protein stability to ensure valid and reproducible results .

How can researchers distinguish between direct effects on KdpB versus indirect effects through the KdpFABC complex?

Distinguishing direct effects on KdpB from indirect effects mediated through other components of the KdpFABC complex requires a multi-faceted experimental approach:

  • Isolated component studies: Express and purify KdpB alone to study its intrinsic properties, then compare with the complete KdpFABC complex to identify differences .

  • Mutational analysis: Introduce specific mutations in KdpB while keeping other complex components unchanged. This approach can identify residues directly involved in KdpB function versus those mediating interactions with other subunits .

  • Interaction disruption: Use peptides or small molecules that specifically disrupt the interaction between KdpB and other complex components (e.g., KdpC) to assess which functions are dependent on these interactions .

  • Chimeric protein approach: Create chimeric proteins replacing domains of KdpB with corresponding domains from other P-type ATPases to identify regions specific to KdpB function.

  • In vitro reconstitution: Systematically reconstitute the complex with different combinations of subunits to determine the minimal components required for specific functions .

These approaches collectively provide a comprehensive understanding of direct versus indirect effects on KdpB function.

What HPLC methods are optimal for analyzing nucleotide binding to KdpB?

HPLC analysis of nucleotide binding to KdpB requires a specialized approach that combines nucleotide extraction and high-resolution chromatography. Based on established methodologies for G-proteins , the following optimized protocol is recommended:

  • Sample preparation:

    • Incubate purified KdpB or KdpFABC complex with nucleotides (ATP, GMPPNP, or GDP)

    • Wash extensively to remove unbound nucleotides

    • Heat-extract bound nucleotides (typically 95°C for 2 minutes)

    • Centrifuge to remove denatured protein

  • HPLC conditions:

    • Use ion-paired, reverse-phase HPLC-UV for optimal nucleotide separation

    • Column: C18 reverse-phase (e.g., 4.6 × 250 mm, 5 μm particle size)

    • Mobile phase: Typically phosphate buffer with ion-pairing agent (e.g., tetrabutylammonium hydrogen sulfate)

    • Detection: UV absorbance at 254-260 nm

  • Data analysis:

    • Quantify individual nucleotide components using peak area

    • Calculate bound nucleotide:protein ratio

    • Determine the distribution between different nucleotide states

This method allows for precise quantification of nucleotide binding and has been validated by showing excellent agreement between total nucleotide concentration measured by HPLC-UV and total protein concentration measured independently .

What experimental controls are essential when studying KdpB ATP hydrolysis activity?

When investigating KdpB ATP hydrolysis activity, implementing appropriate controls is crucial for obtaining reliable and interpretable results:

  • Negative controls:

    • Heat-inactivated KdpB (denatured protein)

    • ATP incubated without KdpB (spontaneous hydrolysis rate)

    • KdpB with non-hydrolyzable ATP analogs (e.g., AMP-PNP)

  • Positive controls:

    • Well-characterized P-type ATPase with known activity

    • Previously validated KdpB preparation with established activity

  • Specificity controls:

    • KdpB with alternative nucleotides (GTP, CTP, UTP)

    • KdpB with varying concentrations of K⁺ to demonstrate ion specificity

  • Technical controls:

    • Samples without added Mg²⁺ (cofactor for ATP hydrolysis)

    • Time-course measurements to ensure linearity of reaction

    • Multiple protein concentrations to confirm enzyme-dependent activity

  • Validation controls:

    • Independent methods to confirm ATP hydrolysis (e.g., colorimetric phosphate detection and HPLC-based ATP consumption)

These controls help distinguish KdpB-specific ATP hydrolysis from background activity and ensure that measured effects are directly attributable to the protein's catalytic function.

What are the recommended approaches for designing site-directed mutagenesis experiments to study KdpB function?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in KdpB. When designing such experiments, consider the following systematic approach:

  • Target selection:

    • Conserved residues identified through sequence alignment of KdpB orthologs

    • Residues in the predicted ATP-binding pocket

    • Residues at the interface with KdpC or other complex components

    • Residues implicated in potassium coordination or transport

  • Mutation strategy:

    • Conservative substitutions (maintaining similar properties)

    • Non-conservative substitutions (altering chemical properties)

    • Alanine scanning of specific domains

    • Introduction of cysteines for subsequent labeling experiments

  • Experimental design:

    • Create a comprehensive mutation matrix covering all key domains

    • Include both single and double mutants to identify potential compensatory effects

Table 2: Example Mutation Matrix Design for KdpB Functional Domains

DomainConserved ResiduesConservative MutationsNon-Conservative MutationsExpected Functional Impact
ATP-bindingD307, K308, T309D307E, K308R, T309SD307A, K308A, T309AReduced ATP binding/hydrolysis
PhosphorylationD332D332ED332A, D332NLoss of phosphorylation
K⁺ coordinationE599, D600E599D, D600EE599A, D600AAltered K⁺ specificity
KdpC interactionR146, Y150R146K, Y150FR146A, Y150ADisrupted complex formation
  • Functional assays:

    • ATP hydrolysis activity

    • Potassium transport measurements

    • Nucleotide binding assays

    • Protein-protein interaction studies

  • Structural validation:

    • Circular dichroism to confirm proper folding

    • Limited proteolysis to assess domain stability

    • Thermal shift assays to evaluate protein stability

This comprehensive approach allows for systematic characterization of KdpB functional domains and the specific residues critical for different aspects of its activity.

How should researchers interpret contradictory findings between in vitro and in vivo KdpB studies?

Contradictions between in vitro and in vivo findings on KdpB function are not uncommon and require careful analysis to resolve. When facing such discrepancies, consider the following analytical framework:

  • Context-dependent function assessment:

    • In vitro systems lack the complete cellular environment that may include unidentified regulatory factors

    • The isolated KdpB or even the complete KdpFABC complex in vitro may lack physiologically relevant interactions with other cellular components

    • Membrane composition differences between artificial liposomes and native membranes may affect protein function

  • Methodological considerations:

    • Variations in experimental conditions (pH, temperature, ionic strength)

    • Different protein preparation methods potentially affecting protein conformation

    • Sensitivity and specificity limitations of different detection methods

  • Reconciliation strategies:

    • Identify the minimal system required to replicate in vivo observations

    • Systematically add cellular components to in vitro systems to identify missing factors

    • Develop intermediate models (e.g., spheroplasts, membrane vesicles) that bridge pure in vitro and in vivo conditions

    • Use complementary methodologies to validate key findings across different experimental platforms

  • Integrated data analysis:

    • Develop mathematical models that account for differences in experimental conditions

    • Use Bayesian approaches to integrate data from multiple experimental paradigms

    • Identify patterns of results that are consistent across different experimental contexts

When reporting contradictory findings, clearly document all experimental conditions and consider publishing detailed methods sections or protocols to facilitate replication and extension by other researchers .

What statistical approaches are most appropriate for analyzing KdpB activity data?

Selecting appropriate statistical methods for analyzing KdpB activity data depends on the experimental design and data characteristics. For robust analysis, consider the following approaches:

  • For comparing multiple KdpB variants or conditions:

    • One-way ANOVA followed by post-hoc tests (e.g., Tukey's HSD) for normally distributed data

    • Kruskal-Wallis test followed by Dunn's test for non-normally distributed data

    • Report effect sizes (e.g., Cohen's d) alongside p-values to indicate biological significance

  • For enzyme kinetics analysis:

    • Non-linear regression to fit Michaelis-Menten or Hill equations

    • Bootstrap resampling to generate confidence intervals for kinetic parameters

    • AIC (Akaike Information Criterion) to compare different kinetic models

  • For time-course experiments:

    • Repeated measures ANOVA for normally distributed data

    • Mixed-effects models to account for random and fixed effects

    • Time-series analysis for complex temporal patterns

  • For structure-function relationships:

    • Multiple regression or partial least squares to correlate structural parameters with functional outcomes

    • Principal component analysis to identify patterns in mutational data

    • Cluster analysis to group mutations with similar functional impacts

Table 3: Recommended Statistical Approaches Based on Experimental Design

Experimental DesignData TypeRecommended Statistical ApproachReporting Format
Single KdpB variant across conditionsContinuousPaired t-test or repeated measures ANOVAMean ± SD, p-value, effect size
Multiple KdpB variantsContinuous, normal distributionOne-way ANOVA with post-hoc testsMean ± SD, F-statistic, p-value
Dose-responseContinuousNon-linear regression (4-parameter logistic)EC50/IC50 with 95% CI
Enzyme kineticsRate vs. substrate concentrationNon-linear regression (Michaelis-Menten)Km, Vmax with 95% CI

Ensure that statistical analysis is appropriate for the experimental design and that assumptions of statistical tests are verified and reported .

How can researchers determine if observed changes in KdpB are physiologically relevant?

Establishing the physiological relevance of observed changes in KdpB function requires multiple lines of evidence connecting molecular mechanisms to cellular and organismal outcomes:

  • Magnitude assessment:

    • Compare the magnitude of observed effects to known physiological variations

    • Determine if changes exceed normal biological noise or homeostatic compensation capacity

    • Calculate effect sizes and confidence intervals to quantify the robustness of findings

  • Correlation with physiological parameters:

    • Measure bacterial growth rates under potassium limitation

    • Assess membrane potential changes in response to KdpB alterations

    • Monitor cellular potassium levels using selective probes or atomic absorption spectroscopy

  • Evolutionary conservation analysis:

    • Examine if affected residues or domains are conserved across species

    • Determine if natural variants exist with similar functional changes

    • Assess whether observed effects correlate with ecological niches or potassium availability

  • Multi-scale validation:

    • Connect molecular changes to cellular phenotypes

    • Link cellular phenotypes to organismal fitness

    • Demonstrate effects under physiologically relevant conditions (e.g., varying K⁺ concentrations typical of natural environments)

  • Integrative modeling:

    • Develop quantitative models that integrate biochemical data into cellular contexts

    • Perform sensitivity analyses to determine which parameters most strongly influence physiological outcomes

    • Use these models to predict conditions where effects would be most pronounced

By systematically addressing these aspects, researchers can establish stronger connections between molecular observations and their biological significance, avoiding overinterpretation of statistically significant but physiologically irrelevant findings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.